KEGG   Corynebacterium diphtheriae CDCE 8392: CDCE8392_2232Help
Entry
CDCE8392_2232     CDS       T01700                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
cdd  Corynebacterium diphtheriae CDCE 8392
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cdd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDCE8392_2232
Enzymes [BR:cdd01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     CDCE8392_2232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2394589..2395404)
Genome map
AA seq 271 aa AA seqDB search
MGDRPRSASSTNNTSNIGSAAWVGGAILTRMSTIVDMPETRGHLISAITTASDPGEILYL
SSRADFSEGGSIRGGVPIIAPWFAKNLGHDELQHGWARRVEWETIPTNGGIDARTSHDDW
DLRLGTQVLPHGFAMMLKARNASPLRRDFQSAFHPYFRVADVRTTTVTVGDQEFRFDGTA
VDQAVPLPEWTPLVIKDSQRTITVTYQGADHAVVWNPGSELAAQMTDVGEGEWTEFVCVE
PALLGDHAQGISVPPWDWVEIGMTVKVTPAQ
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgggagatcgtccgcgcagcgcaagcagtacaaacaacacaagcaacataggcagcgcg
gcttgggtcggcggggctatccttacaagaatgagcaccattgtagatatgcctgagact
cgcggacatttgatatctgcgattactaccgccagcgatcctggcgaaattctttactta
tccagtcgcgcggatttttccgagggtggttcgatccgtggcggtgtcccgatcatcgca
ccgtggtttgctaagaacttgggacacgatgagttgcagcatggttgggcgcgccgagtg
gagtgggagacgatccctaccaatggcggtatcgacgcccgcacgagccacgatgattgg
gatctgcgccttggcacgcaggtacttcctcatggttttgccatgatgttgaaggcccgc
aacgcttccccactgcgtcgcgatttccaatccgcgttccacccgtatttccgcgttgct
gacgtgcgcaccaccaccgtaacggtgggcgatcaggagtttcgtttcgacggcaccgcc
gtcgaccaagcggttcctctgccagagtggacgccgctggttatcaaggattcccagcgc
actattactgtcacctaccaaggtgccgatcatgctgtggtgtggaatcctggcagcgag
cttgccgcacagatgacagatgtgggcgaaggtgaatggaccgagtttgtttgtgtagaa
ccagcattgttgggtgaccacgcccaaggtatttctgttcccccttgggattgggtagag
atcggcatgaccgtgaaagtcacaccggctcagtaa

DBGET integrated database retrieval system