KEGG   Corynebacterium diphtheriae CDCE 8392: CDCE8392_2241Help
Entry
CDCE8392_2241     CDS       T01700                                 

Gene name
trpB1
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cdd  Corynebacterium diphtheriae CDCE 8392
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cdd01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cdd00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cdd00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2401406..2402737
Genome map
AA seq 443 aa AA seqDB search
MTDSTLRKTLISAYFGNYGGQFVPDALLPVLDELEQAYVDALNDPEFSRELARLQKHYLG
RPTPITECANLPLAGKGKGKARIFLKREDLVHGGAHKGNQVLAQALIARRLGKTRLIAET
GAGQHGTATAMVAALMGMDCTIYMGAKDVARQQPNVYRMRLMGATVVPVTNEHGDSMSDA
IDVALMDWVENLDTTHYLIGSAVGPHPFPTLVKEFQAVISRESREQMLELTGKLPDAVVA
AVGGGSNAIGAFADYLTDKPGNESVRLIGVEPAGEGLDSGKHGAPLQRGKVGVQHGFKSF
ILADEQGNPLHSYSVSAGLDYPGVGPEHAHLMESGRAQYYGITDAEALQAFRMLSRYEGI
IPALESSHALAYALKMAENAEETDTPINIVVNLSGRGDKDVDYVRNILGDLATEDPATSP
VTNPHVTETLAAMIAESNAREGV
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgactgactccaccctccgtaagacgttaatcagcgcctactttggtaactacggcgga
cagtttgttcccgatgcgctcctgccggttctcgacgaactagagcaggcctatgtggat
gcactcaacgacccagagttttcgcgggaacttgctcggctacaaaagcactaccttggt
cgtcccactcctattaccgaatgcgctaacctccccctagcgggtaaggggaagggtaag
gcgcggatcttcctcaaacgcgaggatctagttcacggtggcgcgcataagggcaatcag
gtgcttgcccaggcgttgattgctcgcagattgggtaaaactcgtttgatcgcagaaacc
ggtgctggtcagcacggtaccgccactgcgatggtggcggctttgatgggaatggactgc
accatttatatgggtgctaaagatgtggcccgccagcagcccaatgtgtatcgcatgcgg
ctcatgggggctacggtggtaccagttaccaacgagcatggtgattctatgtcggatgct
atcgacgtagcgcttatggactgggtggaaaacctagataccacgcactacctgattggt
tctgcggtcggtccacatccgttccctacgctggtcaaggagtttcaggcggttatttcg
cgggaatctcgcgaacagatgctggagctaacaggcaagcttccggacgcagtggttgct
gccgtgggcggtggttcgaatgctattggtgcgtttgcggattatctcacggataagcca
ggtaatgagtccgtgcgcttgattggtgtggagccagcaggtgagggtcttgattccggt
aagcatggtgcgccgctgcagcgtggcaaggttggtgtgcaacacggcttcaagtcgttc
atcttggctgatgagcagggcaatccgctgcattcttattccgtatcggctggtcttgat
tatccaggcgtgggtccagaacacgcccacctcatggaatctggtcgtgcacaatattat
ggaatcaccgatgccgaggcgcttcaagcattccgaatgttgagtcgctacgagggtatc
attccagctttggagtctagccatgcgttggcgtatgccttaaagatggcagaaaacgcc
gaagaaaccgatactcccattaacattgtggtcaatctttcgggtcgtggcgataaggat
gtggactatgttcgcaatatcttaggcgacctcgctaccgaggatccagcaacctcacca
gtcacgaaccctcatgtcaccgaaaccctcgccgcaatgatcgctgagtccaatgcacga
gagggagtctaa

DBGET integrated database retrieval system