KEGG   Corynebacterium diphtheriae CDCE 8392: CDCE8392_2250Help
Entry
CDCE8392_2250     CDS       T01700                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cdd  Corynebacterium diphtheriae CDCE 8392
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cdd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CDCE8392_2250 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CDCE8392_2250 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CDCE8392_2250 (trpA)
Enzymes [BR:cdd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CDCE8392_2250 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2411076..2411912
Genome map
AA seq 278 aa AA seqDB search
MTRYTKLFSALSAKNEGAFVPFIMLGDPTPEASLAIIRTAVAAGADALELGVPFSDPVAD
GPTIQRSHLRALDNGATVDSSLELIRQIRKEFPELPIGMLIYGNVVFTRGITQFYQEFAD
AGVDSILLPDVPVREGEPFIAAAKQPGIDPIFIAPAQASEATLEEVAQHSSGYIYAISRD
GVTGTERESSTRGLEQVVANVKRFGGAPILLGFGISTPEHVRDAIAAGASGAITGSALTS
IIERHTTGTHPEPAQVTDLEALTEEIFAFVKDMKAATR
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgactcgctacaccaaattattctccgcactcagcgccaaaaacgaaggagcattcgtc
cccttcatcatgctgggcgatcccaccccagaggcgtcgttagcaatcatccgtaccgcc
gttgccgcgggtgccgacgccctcgaactcggcgtccccttctccgacccggtagcagac
ggccccacaatccaacgctcccacctccgtgccctcgacaacggagccaccgtcgatagc
tcgctggaactgatccgacagatccgcaaagaattccccgaacttcccatcggcatgctc
atctacggcaacgttgtcttcacccgcgggatcacccagttctatcaagaattcgccgac
gccggcgtagactccatcctgcttcccgacgtccctgtccgcgaaggcgagcctttcatc
gcagctgccaagcaacctgggatcgaccccatcttcatcgcccccgcacaagcctcggaa
gcaaccttggaagaggtagcgcaacactccagcggatacatctacgccatctcccgcgat
ggtgtgaccggaaccgaacgggaatcctctactaggggactagagcaagtggtagcaaat
gtgaaacgcttcggcggtgcaccgatcctgctcggtttcggcatctccacacccgagcat
gtgcgcgacgccatcgcggcaggagccagcggcgccattacaggctccgcgctgacgtcg
atcatcgagcggcacaccacaggcacacacccagagccagcccaagtgacagaccttgag
gctctcaccgaagaaattttcgcgttcgttaaagacatgaaagccgcaacccgttaa

DBGET integrated database retrieval system