KEGG   Corynebacterium diphtheriae HC02: CDHC02_0314Help
Entry
CDHC02_0314       CDS       T01694                                 

Gene name
rmlD
Definition
dTDP-4-dehydrorhamnose reductase
Orthology
K00067  
dTDP-4-dehydrorhamnose reductase [EC:1.1.1.133]
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
cde  Corynebacterium diphtheriae HC02
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cde00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    CDHC02_0314 (rmlD)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CDHC02_0314 (rmlD)
Enzymes [BR:cde01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.133  dTDP-4-dehydrorhamnose reductase
     CDHC02_0314 (rmlD)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     CDHC02_0314 (rmlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(309886..311232)
Genome map
AA seq 448 aa AA seqDB search
MQVRPTAIAGVVIVDLDVHGDNRGWFKENWQREKMVAAGLSDFQPVQNNISFNAERGVTR
GLHAEPWDKFVSVAHGEVFGAWCDLREGSDTFGEVVTCTITPHTAVFVPRGVANGFQALV
DNTSYTYLVNDHWSPDATYTAVNLDMIDWPLPPTEISDKDRCHPQLADATPMPPRRILIT
GAHGQLGRALAELLPDAELCSHADFDVVNPPQRPWRQYEAIINCAAYNNVDAAEDDRARA
WEVNAVAPARLAQIATENNLTLVHVSTDFIFDGTTLVHEETEAPSPLSVYGASKAAGDIA
AAVTPKHYVVRTSWVFGQGGNFVETMRLLAQRGIRPNVISDQRGRPTHAADLAAGIVHLL
RSGADYGVYNLSNSGDVVGRDDLARAVFEHCGVSGAAVTSVTTAEYETLTGPLAQRPAES
TFNLDKIGATGFQPRPWRDAVRDYLDTK
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgcaggttcgccccactgccattgccggtgttgttattgtcgacctcgacgttcatggc
gataaccgtggatggttcaaagagaactggcagcgggagaaaatggtggcggcgggcttg
tcggatttccaaccagtacaaaacaacatttcttttaacgctgagcgaggcgtgacacgt
ggtttgcacgccgagccatgggataagttcgtgtcggtggctcatggtgaggtgtttggt
gcgtggtgtgacctgcgcgagggttctgacaccttcggcgaggtagtcacctgcaccatt
acccctcatactgcggtgtttgtgccgcgtggggtggccaatggttttcaggcgctggta
gacaacacaagttacacctacttggtcaacgaccattggtcgccggacgctacgtatacg
gcggtgaatttggacatgattgattggccgcttcctcccacggagatttcggataaggat
cgttgccacccccagcttgccgacgccaccccgatgccaccgcgtcgcattctcatcacc
ggcgcccatggccagttggggcgtgcgctagccgagttgttgccggatgccgagttgtgt
tcgcatgctgatttcgatgtggttaacccaccgcagcgcccgtggcgccagtatgaggcg
attattaactgtgcggcctacaacaatgtggatgcggcagaagatgatcgtgcccgtgca
tgggaggtcaatgctgttgccccagcaaggctggcccagattgctacggagaataatctg
acgttggtgcatgtgtcgacggatttcattttcgacggcaccacgttagtgcatgaggag
acggaagcgccgtcgccgttgtcggtgtacggggcgtcgaaggctgcgggtgatattgcg
gctgctgtgacaccgaaacactatgtggtgcgtacgtcgtgggtctttggccaaggtggc
aactttgtggaaactatgcgcttgctggcgcagcgcgggattcgccccaatgtgattagc
gatcagcggggtcgtccaacccatgcggctgatctggcggcgggtattgtgcatttgctg
cgcagcggcgcagattatggtgtgtacaacctttctaattctggcgatgtggtcggccgc
gatgatcttgcccgcgcggtatttgagcattgtggggtatccggtgcggcggtaacctct
gttaccacagccgagtacgagaccctaacaggtccgttggcccagcgccccgcggagtcg
acgttcaacttggacaaaattggggcgacgggttttcaaccgcgcccgtggcgggatgct
gtgcgtgactacttagacaccaagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system