KEGG   Corynebacterium diphtheriae HC02: CDHC02_0339Help
Entry
CDHC02_0339       CDS       T01694                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cde  Corynebacterium diphtheriae HC02
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CDHC02_0339 (gpmA)
   01230 Biosynthesis of amino acids
    CDHC02_0339 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDHC02_0339 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    CDHC02_0339 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CDHC02_0339 (gpmA)
Enzymes [BR:cde01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CDHC02_0339 (gpmA)
Exosome [BR:cde04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CDHC02_0339 (gpmA)
  Exosomal proteins of melanoma cells
   CDHC02_0339 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
338830..339576
Genome map
AA seq 248 aa AA seqDB search
MTTGKLILLRHGQSEWNASNQFTGWVDVNLTEKGEAEAKRGGELLKAQGVLPSVVYTSLL
RRAIRTANIALNAADRHWIPVVRDWRLNERHYGALQGLNKAETKEKYGDEQFMAWRRSYG
TPPPELEDSSEFSQANDPRYANLDVVPRTECLKDVVERFVPYFKEEILPRVQNGETVLIA
AHGNSLRALVKHLDNISDADIAELNIPTGIPLVYELDEAGTVLNPGGTYLDPEAAAAGAA
AVAAQGAK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgactactggaaaactgattcttcttcgtcacggacaaagcgaatggaacgcttccaac
caattcaccggctgggtggacgtcaacctcaccgaaaagggcgaggcagaggctaagcgc
ggcggcgaactgctcaaggctcagggggtcctgccaagcgtggtttacacctctttgctg
cgccgtgctatccgcaccgccaacattgctctgaacgctgctgatcgccattggatccca
gttgttcgcgattggcgcctcaacgagcgccactacggtgcgctgcagggcctgaacaag
gctgagactaaggaaaagtacggcgacgagcagttcatggcatggcgtcgttcttatggc
accccaccaccagagcttgaggattccagcgagttctcccaggcaaacgatcctcgttat
gccaaccttgacgtggttcctcgcaccgagtgcttgaaggacgttgttgagcgtttcgtt
ccttacttcaaggaagagatcctgccacgtgtgcagaacggtgagactgttttgatcgct
gcacacggtaactccctgcgtgcattggtcaagcacctagacaacatctctgatgcagac
atcgctgagctcaacatccctaccggtattccactggtttatgagctcgacgaggctggc
acggtgctcaacccaggtggcacctaccttgacccagaagctgctgctgccggtgctgcc
gcagttgctgctcagggcgctaagtag

DBGET integrated database retrieval system