KEGG   Corynebacterium diphtheriae HC02: CDHC02_0463Help
Entry
CDHC02_0463       CDS       T01694                                 

Definition
putative regulatory protein sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cde  Corynebacterium diphtheriae HC02
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CDHC02_0463
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDHC02_0463
   00052 Galactose metabolism
    CDHC02_0463
   00500 Starch and sucrose metabolism
    CDHC02_0463
   00520 Amino sugar and nucleotide sugar metabolism
    CDHC02_0463
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CDHC02_0463
   00524 Butirosin and neomycin biosynthesis
    CDHC02_0463
Enzymes [BR:cde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CDHC02_0463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
467070..467954
Genome map
AA seq 294 aa AA seqDB search
MTHALGVDIGGTKIAVGIVDTTDPTTVISRHIVATPDNDVIDHVRDAIAHIITPEVTSIG
IGAPGVIDETTGVVVSSGPTMQGWAGTRIADTIAAEFSLPVAVHNDVRVMGLGESIYGAG
RDYTNVLFVSLGTGVGGAIVRDGRLVASPHHTAGELRALIGRLPDGRADLLENFAAGPGL
AQRFGELYSEHAGRDLRFIMELYRAGDTHARDYITATLAAAGETIAGFASAIDVDAIIIG
GGVGNIGDAIIKPFAHGFAAHAIPPLGTIPIRQAQLGTDAPIVGAAHLGHSAIE
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgacacacgcactcggtgtcgacatcggcggtaccaaaatcgcagtcggaatcgtagac
accaccgatcccaccaccgtaatcagccgacacattgtagccacacccgacaacgacgtg
atcgaccacgtacgcgacgcgatcgcccacatcatcaccccagaagtaaccagcattggc
atcggcgcgccgggtgttatcgacgaaaccacaggcgtagtcgtctcctccggtcccacc
atgcaaggctgggctggcacacgcatcgcggatactatcgccgcggaattttcgctaccc
gtcgccgtgcataacgacgtccgcgtcatggggctcggcgaatccatctacggcgccgga
cgcgactacaccaatgtgctctttgtcagccttgggacaggtgtcggcggcgccattgtt
cgtgacggacgcctcgtagcatccccgcaccacactgcaggcgaacttcgggcactcatc
ggcaggcttcccgacggccgcgcagacctcctagaaaacttcgccgcaggacccggcttg
gcacaaagattcggtgaactctactccgaacacgcaggtcgtgacctgcgattcatcatg
gagctctaccgcgcaggagacacccacgcccgcgactacatcacagcgacgcttgcagca
gcaggcgaaaccatcgcaggattcgccagcgccatcgacgtagacgccatcatcatcggc
ggcggagtaggcaacatcggcgacgccatcatcaaaccatttgcccacggattcgcagcc
cacgccattccaccgctaggaacgatccccatccggcaagcacaacttggcaccgacgca
cctatcgtcggcgcagcacaccttggccacagcgccatcgaataa

DBGET integrated database retrieval system