KEGG   Corynebacterium diphtheriae HC02: CDHC02_0727Help
Entry
CDHC02_0727       CDS       T01694                                 

Gene name
echA2
Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cde  Corynebacterium diphtheriae HC02
Pathway
cde00071  Fatty acid degradation
cde00280  Valine, leucine and isoleucine degradation
cde00310  Lysine degradation
cde00360  Phenylalanine metabolism
cde00380  Tryptophan metabolism
cde00410  beta-Alanine metabolism
cde00627  Aminobenzoate degradation
cde00640  Propanoate metabolism
cde00650  Butanoate metabolism
cde00903  Limonene and pinene degradation
cde01100  Metabolic pathways
cde01110  Biosynthesis of secondary metabolites
cde01120  Microbial metabolism in diverse environments
cde01130  Biosynthesis of antibiotics
cde01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cde00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CDHC02_0727 (echA2)
   00650 Butanoate metabolism
    CDHC02_0727 (echA2)
  Lipid metabolism
   00071 Fatty acid degradation
    CDHC02_0727 (echA2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CDHC02_0727 (echA2)
   00310 Lysine degradation
    CDHC02_0727 (echA2)
   00360 Phenylalanine metabolism
    CDHC02_0727 (echA2)
   00380 Tryptophan metabolism
    CDHC02_0727 (echA2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CDHC02_0727 (echA2)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CDHC02_0727 (echA2)
   00281 Geraniol degradation
    CDHC02_0727 (echA2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CDHC02_0727 (echA2)
   00627 Aminobenzoate degradation
    CDHC02_0727 (echA2)
   00930 Caprolactam degradation
    CDHC02_0727 (echA2)
Enzymes [BR:cde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CDHC02_0727 (echA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEX76221
Position
756352..757113
Genome map
AA seq 253 aa AA seqDB search
MRIDGHLMCVTLNRHEARNALSAQMCDDITSALNNADEQARDTAAIRAVLIRSVGTTFCA
GADLGSTTQSDDAAEVTQSDFHDSLTRMLESVVSCGVPVIADIQGPAVGAGMQLALSCDL
RLVHHAAWFKVPAASLGFALDGWTINRAQCLLGGGWARSIFLGGATLSAPQAVATGFALE
IADSDSAIAYAHRIAGMAPLALRQLKSALNSADFEYALVGESRDLFAQCWASTDAREGQL
ARKQKRDPVFTGR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtatcgacggccacctgatgtgtgtcaccttaaatagacacgaggctcgcaacgca
ctttctgcacagatgtgcgatgatattacatctgctcttaataatgcagatgagcaggcg
cgtgacactgcagctattcgcgccgtgctcatccgctctgttggtacgaccttttgtgcc
ggagcagatttgggcagcaccacccaaagtgatgatgcggctgaggtgacgcagtcggat
ttccatgactctcttacgcgcatgttggaatcggttgtttcctgtggagtcccagttatt
gctgatattcaaggaccagctgtcggcgctggcatgcagctggcattgagctgcgacctg
cgtttggttcatcatgctgcatggtttaaggtcccggcggcgtctcttgggttcgcgctg
gacggatggactattaatagggctcagtgtttgctgggcggtggttgggcgcgatcaatt
ttcttgggcggcgcaacgctatcggcaccgcaggcggtggcaactggttttgcgctggag
atcgctgattccgattctgcgattgcctatgctcatcgtattgctggaatggcacccttg
gcgctgcgacaacttaaatccgcgctcaacagtgctgattttgaatatgcgcttgttggg
gaatctcgtgatctttttgcccaatgttgggctagtacggatgctcgcgaagggcagctg
gctcgaaaacaaaagcgagatccggtatttactggtcgctga

DBGET integrated database retrieval system