KEGG   Corynebacterium diphtheriae HC02: CDHC02_0727Help
Entry
CDHC02_0727       CDS       T01694                                 

Gene name
echA2
Definition
(RefSeq) enoyl-CoA hydratase (EC:4.2.1.17)
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cde  Corynebacterium diphtheriae HC02
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Phenylalanine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cde00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CDHC02_0727 (echA2)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CDHC02_0727 (echA2)
   00650 Butanoate metabolism
    CDHC02_0727 (echA2)
  Lipid metabolism
   00071 Fatty acid degradation
    CDHC02_0727 (echA2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CDHC02_0727 (echA2)
   00310 Lysine degradation
    CDHC02_0727 (echA2)
   00360 Phenylalanine metabolism
    CDHC02_0727 (echA2)
   00380 Tryptophan metabolism
    CDHC02_0727 (echA2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CDHC02_0727 (echA2)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CDHC02_0727 (echA2)
   00281 Geraniol degradation
    CDHC02_0727 (echA2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CDHC02_0727 (echA2)
   00627 Aminobenzoate degradation
    CDHC02_0727 (echA2)
   00930 Caprolactam degradation
    CDHC02_0727 (echA2)
Enzymes [BR:cde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CDHC02_0727 (echA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
756352..757113
Genome map
AA seq 253 aa AA seqDB search
MRIDGHLMCVTLNRHEARNALSAQMCDDITSALNNADEQARDTAAIRAVLIRSVGTTFCA
GADLGSTTQSDDAAEVTQSDFHDSLTRMLESVVSCGVPVIADIQGPAVGAGMQLALSCDL
RLVHHAAWFKVPAASLGFALDGWTINRAQCLLGGGWARSIFLGGATLSAPQAVATGFALE
IADSDSAIAYAHRIAGMAPLALRQLKSALNSADFEYALVGESRDLFAQCWASTDAREGQL
ARKQKRDPVFTGR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtatcgacggccacctgatgtgtgtcaccttaaatagacacgaggctcgcaacgca
ctttctgcacagatgtgcgatgatattacatctgctcttaataatgcagatgagcaggcg
cgtgacactgcagctattcgcgccgtgctcatccgctctgttggtacgaccttttgtgcc
ggagcagatttgggcagcaccacccaaagtgatgatgcggctgaggtgacgcagtcggat
ttccatgactctcttacgcgcatgttggaatcggttgtttcctgtggagtcccagttatt
gctgatattcaaggaccagctgtcggcgctggcatgcagctggcattgagctgcgacctg
cgtttggttcatcatgctgcatggtttaaggtcccggcggcgtctcttgggttcgcgctg
gacggatggactattaatagggctcagtgtttgctgggcggtggttgggcgcgatcaatt
ttcttgggcggcgcaacgctatcggcaccgcaggcggtggcaactggttttgcgctggag
atcgctgattccgattctgcgattgcctatgctcatcgtattgctggaatggcacccttg
gcgctgcgacaacttaaatccgcgctcaacagtgctgattttgaatatgcgcttgttggg
gaatctcgtgatctttttgcccaatgttgggctagtacggatgctcgcgaagggcagctg
gctcgaaaacaaaagcgagatccggtatttactggtcgctga

DBGET integrated database retrieval system