KEGG   Corynebacterium diphtheriae HC02: CDHC02_0997Help
Entry
CDHC02_0997       CDS       T01694                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
cde  Corynebacterium diphtheriae HC02
Pathway
cde00010  Glycolysis / Gluconeogenesis
cde00030  Pentose phosphate pathway
cde00051  Fructose and mannose metabolism
cde00052  Galactose metabolism
cde00680  Methane metabolism
cde01100  Metabolic pathways
cde01110  Biosynthesis of secondary metabolites
cde01120  Microbial metabolism in diverse environments
cde01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cde00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDHC02_0997 (pfkA)
   00030 Pentose phosphate pathway
    CDHC02_0997 (pfkA)
   00051 Fructose and mannose metabolism
    CDHC02_0997 (pfkA)
   00052 Galactose metabolism
    CDHC02_0997 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    CDHC02_0997 (pfkA)
Enzymes [BR:cde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CDHC02_0997 (pfkA)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     CDHC02_0997 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AEX76489
Position
1039656..1040684
Genome map
AA seq 342 aa AA seqDB search
MRIATLTSGGDCPGLNAVIRGIVRTCSEYGSTVVGYQDGWVGLMEDKRIQLYDDENIDRI
LLRGGTILGTGRLHPDKFKSGLDQIKANLEDAGIDALIPIGGEGTLKGAKWLSDNGIPVV
GVPKTIDNDVNGTDYTFGFDTAVSVATDAIDRLHTTAESHNRVMIVEVMGRHVGWIALHA
GMAGGAHYTVIPEQPFDIAEICKAMERRFQMGEKYGIIVVAEGALPKEGTMDFVEGGVDQ
FGHQTFNGIGQVIGEEIKKRLGHDVRTTVLGHIQRGGTPTSYDRVLATRYGVHAARACHN
GDYGKMVALHGEHIDLIPLEDAVDTLKTVPEGRYRTARALFG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattgcgactcttacatccggcggcgattgccccggcctcaacgctgtgatccgc
ggcattgtccgcacatgttctgagtacggctcgaccgtcgttggataccaagacggctgg
gtggggctcatggaagacaagcgcattcaactatatgacgatgaaaacatcgatcgtatc
ctgttgcgcggcggaaccattttgggtaccggccgccttcaccctgacaagtttaagtct
ggtcttgaccagattaaggcaaaccttgaggatgcaggtattgatgcactgattcctatc
ggtggcgaaggtacgctcaagggtgccaaatggctatctgataatggtattcctgtagtt
ggcgtgcctaagacgattgacaacgacgttaacggtacggattacacttttggctttgat
accgcagtctctgttgctacggatgctatcgaccgactgcacactacagctgagtctcac
aaccgtgtgatgatcgttgaggttatgggtcgtcacgttggctggattgcgctgcacgcc
ggcatggcaggcggtgcgcattacacagtcattcctgagcagccatttgatattgcagag
atctgcaaggcaatggaacgtcgcttccagatgggtgaaaagtacggcattatcgtcgtg
gcggaaggtgcattgcctaaggaaggcacgatggactttgtcgagggcggcgtcgaccaa
tttggccaccaaacgtttaatggcattggtcaagtaattggtgaggaaatcaagaagcgc
ctcggccatgacgttcgtaccacggttttgggtcatatccagcgtggtggcacacctact
tcttatgaccgcgttttggctacccgttacggtgttcatgccgcacgtgcgtgccacaac
ggtgattacggcaagatggttgcgttgcacggtgaacatatcgatctgattccgctcgag
gacgcggtagatacgctaaagactgtccctgaaggacgttaccgcacagcacgcgccctg
tttggctaa

DBGET integrated database retrieval system