KEGG   Corynebacterium diphtheriae HC02: CDHC02_1442Help
Entry
CDHC02_1442       CDS       T01694                                 

Gene name
trpC2
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cde  Corynebacterium diphtheriae HC02
Pathway
cde00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cde01100  Metabolic pathways
cde01110  Biosynthesis of secondary metabolites
cde01130  Biosynthesis of antibiotics
cde01230  Biosynthesis of amino acids
Module
cde_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cde00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CDHC02_1442 (trpC2)
Enzymes [BR:cde01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CDHC02_1442 (trpC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh QRPTase_C OMPdecase PDZ
Motif
Other DBs
NCBI-ProteinID: AEX76931
Position
complement(1549094..1549900)
Genome map
AA seq 268 aa AA seqDB search
MVTVFDEIIAGVVEDVAAREAQVSFQDIKAQSRLCAPPRDACGALLASGCGIIAEIKRAA
PGQGLLAEIPSPVDLALELESGGAALIACHTERRRFHGSLTEMAKIRRHVSVPVMCRDFI
VDPYQIHEARCYGADMVPLRVAALAQSRLVALIDRVESLGMAALVEVRDTAEASRALDAG
ARIIGVNARDFSTMTLNRAAFCEIAPGLPSDVVRVALSGVRNAKELLDYASAGADAVVIG
QSIVTAQSPRGATRALVAAGQHPSCPSR
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggttacagtcttcgatgagatcatcgctggtgttgtggaagacgttgccgcgcgcgaa
gcgcaggtttcattccaggacatcaaagcgcagtctcgtctgtgcgcgccacctagggat
gcttgtggggcattgttagcaagtggctgtggaatcatcgcggagatcaaaagggcagca
cctggccaaggtttgcttgcggagattccttcgccggtagatctggctcttgagctcgag
tccggcggtgcggcgttgattgcttgtcacacagagcgccggcggtttcatgggtctttg
acggagatggcaaagattcgtcgtcacgtgtccgttccagttatgtgtcgcgattttatt
gttgatccctatcagattcatgaagctcgctgctatggagctgatatggtgccgcttcgg
gtagctgcgcttgcgcagtcacgacttgttgcattgattgatcgggtggaatccctgggg
atggctgcgcttgtcgaggtacgcgatactgcggaggcatctcgtgccttagatgctggt
gctcgaattatcggtgttaatgcgagagatttttctacgatgacccttaaccgagcggct
ttttgcgagatcgctccaggacttcctagcgacgtggtccgagtggcgctttcaggggtt
cgtaatgctaaagagcttttagactacgcctcggctggggcagacgccgtggtgattggc
caaagcatcgtgacggcgcaatcgcctcgaggggcgacgcgtgccttggttgctgcaggc
cagcatccctcgtgtccctcacgttag

DBGET integrated database retrieval system