KEGG   Corynebacterium diphtheriae HC02: CDHC02_1514Help
Entry
CDHC02_1514       CDS       T01694                                 

Gene name
ltsA
Definition
putative asparagine synthetase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cde  Corynebacterium diphtheriae HC02
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cde00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CDHC02_1514 (ltsA)
Enzymes [BR:cde01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     CDHC02_1514 (ltsA)
Peptidases [BR:cde01002]
 Cysteine Peptidases
  Family C44
   CDHC02_1514 (ltsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1628853..1630775
Genome map
AA seq 640 aa AA seqDB search
MCGLLGMLSSTGQASKYAAAIESALPCMHHRGPDEAGTWHDDHAVFGFNRLSIIDLEHSH
QPLRWGPEGEPDRYAMTFNGEIYNYVELRKKLQDLGYTFNTSGDGETIAVGFHHWGADVV
LHLRGMFGIAIWDTKEQRLFLARDQFGIKPLYFATTEAGTVFASEKKCILGMADAIGLDL
GLDQRAIEHYIDLQYVPEPESLHQHIRRLESGCFAFVSVGGNVEQTRYFRPQFPAQEFPK
DKEQDLFDRIAKALEDSVEKHMRADVTVGSFLSGGIDSTAIATLAKRHNPNLLTFTTGFE
REGYSEVDVAAESAAAIGVEHIVKIVSPEEYANAIPQIMWYLDDPVADPSLVPLFFVAQE
ARKHVKVVLSGEGADELFGGYTIYKEPLSLAPFEKIPSPLRRGLGKVAEVFPDGMRGKSL
LQRGSMTMEERYYGNARSFNFDQMKRVIPWAKKEWDHREVTAPIYAQSEHMDPVARMQHL
DLFTWMRGDILVKADKINMAHSLELRVPFLDKEVFEVAETIPYDLKIANGTTKYALRKAM
EQIVPPHVLHRKKLGFPVPMRHWLAGDELFGWAQDTINESMTDQYFDKAAVLAMLNEHKN
GVSDHSRRLWTVLAFMIWHGIFVEHRIDPGIEKRDYPVYL
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggacttctaggcatgctctccagcacaggacaggccagtaagtatgcagctgct
atagaaagtgctttgccgtgcatgcaccaccgaggccctgacgaagcaggtacttggcat
gacgaccatgcagtttttggctttaatcgcctatcgatcatcgatctcgagcattctcac
cagcccttgcgatgggggcctgaaggcgagcccgaccgctatgccatgacttttaatggc
gagatctacaactatgtagagctacgaaaaaaacttcaagacctcggctacacctttaac
acttcaggcgacggcgaaactattgctgtcggtttccaccactggggtgcagatgtagtg
cttcacttgcgcggaatgtttggcatagccatttgggacaccaaggaacaacgtcttttc
ttggcccgcgatcaatttggcatcaagccgttgtactttgctactaccgaagctggcacc
gttttcgcctcggagaaaaagtgcatcttgggtatggcagatgctattggtctagattta
gggcttgaccaacgtgccatcgaacactacatcgatcttcaatacgttccagagcctgaa
agtcttcatcagcacattcgacgcctggagtctggctgctttgctttcgtttctgtggga
ggcaatgtcgagcagactcgttacttccgtcctcagttccccgcacaagaattcccaaag
gacaaggaacaggatctcttcgatcgaatcgccaaggccctagaagatagcgtcgaaaag
cacatgcgtgccgacgtcactgtcggttctttcctgtctggcggcatcgactccactgcg
attgcaactttggcaaaacgccataatccgaatctgttgacattcactacaggatttgaa
cgcgaaggatattcggaagtcgatgtggctgcagaatccgctgctgccattggagtagaa
catatcgttaagattgtctctcccgaggaatatgccaatgccattcctcaaatcatgtgg
tacttggatgatccagtagctgatccctccctagtcccactattcttcgttgctcaagaa
gcccgcaagcatgtcaaagtggtgttgtcaggcgaaggagcagacgaactatttggtggt
tacaccatttacaaagagccgctttctcttgctccatttgaaaagattccttccccgcta
cgtcgcggtcttggcaaagtagccgaagttttccctgacggaatgcgtggtaaatccttg
ctccaacgcggttcgatgacgatggaagagcgttattacggaaatgctcgttccttcaat
tttgatcaaatgaagcgcgttatcccatgggccaagaaggaatgggatcaccgcgaagtc
accgcaccgatctacgcccagtctgagcacatggaccccgttgcgcgaatgcagcatttg
gaccttttcacgtggatgcgcggcgatatcctcgtcaaggccgacaagatcaacatggct
cactccttggagcttcgcgtcccgttcttggataaggaagtatttgaggttgctgaaacc
attccttatgacctcaagattgctaacggaacgaccaaatatgcgttgcgtaaggccatg
gaacaaatcgttccgccgcacgtgctacaccgcaagaaactcggattcccagtgcctatg
cgccactggctagctggcgatgagctgttcggttgggctcaagacaccattaatgagtcg
atgaccgaccaatactttgacaaggcagcagtcttagcaatgctcaatgagcacaagaat
ggtgtatctgatcattcccgcaggctatggacagtccttgcctttatgatttggcacgga
attttcgtcgagcaccgcattgatccaggcatcgagaaacgcgattatcctgtgtaccta
tag

DBGET integrated database retrieval system