KEGG   Corynebacterium diphtheriae HC02: CDHC02_1523Help
Entry
CDHC02_1523       CDS       T01694                                 

Gene name
sucB
Definition
(RefSeq) dihydrolipoamide acetyltransferase (EC:2.3.1.12)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cde  Corynebacterium diphtheriae HC02
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CDHC02_1523 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CDHC02_1523 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    CDHC02_1523 (sucB)
Enzymes [BR:cde01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CDHC02_1523 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1637984..1639567
Genome map
AA seq 527 aa AA seqDB search
MAHSVVMPELGESVTEGTITQWLKSVGDTVTADEPLLEVSTDKVDTEVPSPVSGVLLEIK
FEEDDTVDVGDVIAIIGEEGDAPAAKEEPAEAPKEEPKAEAPKAEAADSTDVVMPELGES
VTEGTITQWLKSVGDTVDVDEPLLEVSTDKVDTEVPSPVAGTILEILFNEDDTVDVGDVI
VRVGTPGSAPAAKEEPAEAPKEEPKKEAPAKTINNENVPYVTPLVRKLADKHGVDLTTVE
GTGIGGRIRKQDVLAAAGVGAAPAAQVAPAQPVSAASTKSVDPEKQKLIGTTQKVNRIRE
ITARKTVEALQISAQLTQLHEVDMTKVAELRKANKPAFQEKHGVNLTYLPFFAKAIVEAL
VAHPNVNASYNAETKEMTYHADVNLSIAVDTPAGLLTPVIHKAQELSLPELAKAIVDLAD
RARNNKLKPNDLSGGTFTITNIGSEGALSDTPILVPPQAGILGTGAIVKRPVVITEDGID
SIAIRQMVYLPLSYDHQIVDGADAGRFLTTIKDRLETANFEGDLELS
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggcgcactccgttgtaatgcctgaactgggcgaatccgtcaccgaaggtaccatcacc
cagtggctgaagtccgttggtgacacggtcactgccgacgagccgttgctcgaggtatct
actgacaaggtcgacactgaagttccttcgcctgtctccggtgtcttgcttgagatcaag
tttgaggaagatgacaccgtagacgtcggagacgttattgcgattattggcgaagaaggc
gacgctccagctgccaaggaagagccagccgaggcaccaaaggaagagccaaaagctgag
gcaccaaaggctgaagcagctgactccaccgacgtagtcatgcctgaactcggcgagtcc
gtcaccgaaggcaccatcacccagtggctgaagtccgttggcgacaccgtcgacgttgac
gaaccactcctcgaagtctccaccgacaaggtcgacaccgaagtcccatccccagtcgct
ggcaccatcctcgaaatcctcttcaacgaagacgacaccgtcgacgtcggagacgtaatc
gttcgcgttggcaccccaggatctgctccagctgccaaggaagagccagccgaggcacca
aaggaagagccaaagaaggaagctcctgccaagaccatcaacaacgagaacgtcccttac
gtcactccgctggtccgcaagctggctgacaagcacggcgttgatctgaccactgttgaa
ggcactggtattggtggacgcatccgcaaacaggatgttttggctgctgctggcgttggc
gcagcccctgcagcacaggttgctcctgcccagccagtttctgcagcatccaccaagtcc
gtggatccagagaagcagaagctgatcggtacaactcagaaggtcaaccgtatccgagag
atcaccgcgcgcaagactgtggaggctttgcagatttctgctcagctcacccagctgcat
gaggtcgatatgactaaggttgcggaactgcgtaaggccaacaagccagccttccaagaa
aagcacggtgtgaacctcacctacttgccattctttgcaaaggcaattgttgaggctttg
gttgctcacccgaacgtcaatgcgtcctacaacgctgagacaaaggagatgacctaccac
gctgatgtcaacctctccatcgccgttgacaccccagctggtctgcttacccctgtaatc
cacaaggctcaagagttgtccttgcctgagctcgctaaggcaattgtcgatttggctgac
cgtgctcgtaacaacaagctcaagccgaatgatctttccggtggcaccttcaccattacc
aacattggttctgagggcgctctcagcgataccccaatcttggttccaccacaggcaggt
atcttgggcaccggcgctattgttaagcgtccagtagtcatcacggaagacggcatcgat
tcgattgctattcgccagatggtctacttgccacttagctacgatcaccagatcgtcgat
ggtgccgatgcaggtcgtttcttgaccaccatcaaggatcgccttgagactgcaaacttc
gaaggcgacctcgaactctcctag

DBGET integrated database retrieval system