KEGG   Corynebacterium diphtheriae HC02: CDHC02_1523Help
Entry
CDHC02_1523       CDS       T01694                                 

Gene name
sucB
Definition
dihydrolipoamide acetyltransferase (EC:2.3.1.12)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cde  Corynebacterium diphtheriae HC02
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CDHC02_1523 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CDHC02_1523 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    CDHC02_1523 (sucB)
Enzymes [BR:cde01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CDHC02_1523 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1637984..1639567
Genome map
AA seq 527 aa AA seqDB search
MAHSVVMPELGESVTEGTITQWLKSVGDTVTADEPLLEVSTDKVDTEVPSPVSGVLLEIK
FEEDDTVDVGDVIAIIGEEGDAPAAKEEPAEAPKEEPKAEAPKAEAADSTDVVMPELGES
VTEGTITQWLKSVGDTVDVDEPLLEVSTDKVDTEVPSPVAGTILEILFNEDDTVDVGDVI
VRVGTPGSAPAAKEEPAEAPKEEPKKEAPAKTINNENVPYVTPLVRKLADKHGVDLTTVE
GTGIGGRIRKQDVLAAAGVGAAPAAQVAPAQPVSAASTKSVDPEKQKLIGTTQKVNRIRE
ITARKTVEALQISAQLTQLHEVDMTKVAELRKANKPAFQEKHGVNLTYLPFFAKAIVEAL
VAHPNVNASYNAETKEMTYHADVNLSIAVDTPAGLLTPVIHKAQELSLPELAKAIVDLAD
RARNNKLKPNDLSGGTFTITNIGSEGALSDTPILVPPQAGILGTGAIVKRPVVITEDGID
SIAIRQMVYLPLSYDHQIVDGADAGRFLTTIKDRLETANFEGDLELS
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggcgcactccgttgtaatgcctgaactgggcgaatccgtcaccgaaggtaccatcacc
cagtggctgaagtccgttggtgacacggtcactgccgacgagccgttgctcgaggtatct
actgacaaggtcgacactgaagttccttcgcctgtctccggtgtcttgcttgagatcaag
tttgaggaagatgacaccgtagacgtcggagacgttattgcgattattggcgaagaaggc
gacgctccagctgccaaggaagagccagccgaggcaccaaaggaagagccaaaagctgag
gcaccaaaggctgaagcagctgactccaccgacgtagtcatgcctgaactcggcgagtcc
gtcaccgaaggcaccatcacccagtggctgaagtccgttggcgacaccgtcgacgttgac
gaaccactcctcgaagtctccaccgacaaggtcgacaccgaagtcccatccccagtcgct
ggcaccatcctcgaaatcctcttcaacgaagacgacaccgtcgacgtcggagacgtaatc
gttcgcgttggcaccccaggatctgctccagctgccaaggaagagccagccgaggcacca
aaggaagagccaaagaaggaagctcctgccaagaccatcaacaacgagaacgtcccttac
gtcactccgctggtccgcaagctggctgacaagcacggcgttgatctgaccactgttgaa
ggcactggtattggtggacgcatccgcaaacaggatgttttggctgctgctggcgttggc
gcagcccctgcagcacaggttgctcctgcccagccagtttctgcagcatccaccaagtcc
gtggatccagagaagcagaagctgatcggtacaactcagaaggtcaaccgtatccgagag
atcaccgcgcgcaagactgtggaggctttgcagatttctgctcagctcacccagctgcat
gaggtcgatatgactaaggttgcggaactgcgtaaggccaacaagccagccttccaagaa
aagcacggtgtgaacctcacctacttgccattctttgcaaaggcaattgttgaggctttg
gttgctcacccgaacgtcaatgcgtcctacaacgctgagacaaaggagatgacctaccac
gctgatgtcaacctctccatcgccgttgacaccccagctggtctgcttacccctgtaatc
cacaaggctcaagagttgtccttgcctgagctcgctaaggcaattgtcgatttggctgac
cgtgctcgtaacaacaagctcaagccgaatgatctttccggtggcaccttcaccattacc
aacattggttctgagggcgctctcagcgataccccaatcttggttccaccacaggcaggt
atcttgggcaccggcgctattgttaagcgtccagtagtcatcacggaagacggcatcgat
tcgattgctattcgccagatggtctacttgccacttagctacgatcaccagatcgtcgat
ggtgccgatgcaggtcgtttcttgaccaccatcaaggatcgccttgagactgcaaacttc
gaaggcgacctcgaactctcctag

DBGET integrated database retrieval system