KEGG   Corynebacterium diphtheriae HC02: CDHC02_1596Help
Entry
CDHC02_1596       CDS       T01694                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cde  Corynebacterium diphtheriae HC02
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cde00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1715070..1717238
Genome map
AA seq 722 aa AA seqDB search
MSYSDLLRELAAAHAISSSYSGFGGAHVEVSDDTLVKTLRSLGVCFGNEDEPATDHEPLT
GPMPSEDQIRYALQQRYDAEATRPLPRCVVAVEGDPYVFNVHVHDGAPADITITLEDGST
AEVTQVENWTPPREVDGITWGEASFQLPSDLPLGWHTITLTSDTLTSSCFLIVTPARLST
ADKYTENPVSGVMAQLYSARSKNSWGMGDFNDLGLLAETLAPQADYLLINPLHAAEPMPP
VEDSPYLPTTRRFINPIYIRIEDIPEHLLLDDDLQDDIAELAAEFTALNLTPKKIERNPI
FDAKLQVLHAVFNVEREPAREQDFQDFIATEGQGLRDFASWCADQELVVLESSAAHAALP
EKESLIQFYMWQQWICDQQLGAAQTRATDAGMSIGIIADLAVGIHPAGADALSLADTLVA
RASVGAPPDSYNHQGQDWSQPPWHPDRLAESGYIPWRDLLRTVLRHAGGVRVDHILGLFR
LFWIPRTQSPQTGTYVNYDHNALVGVLALEAERAGAVVIGEDLGTFEPWVQDFLASRGIM
GTSVLWFESSPEGGPRKQHEYRQLALTSVTTHDLPPTAGYLAGEHIALREELGILTTDVA
TEYAEDLNWQADILNVVRNSGAFESIVPAEFHGVDRADRGSSVELLSALHRFLAGTPSAL
TCTALVDLVADKRAQNQPGTTSDQYPNWCIPLCDESGTPVLIEDLAENPVYQAVTKASTR
LH
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
gtgagttactcagatttgttacgcgagctggccgctgcccacgcaatctcttcgtcgtac
tccggtttcggtggagcacacgtggaagtttcggatgacacgctggtcaagaccctgcga
tccctcggagtttgcttcggaaatgaagacgaacccgccaccgaccacgagcctttgact
gggcctatgcctagcgaggatcaaatccgctacgcgctgcaacaacgttacgacgccgaa
gcaacccgccccctcccccgatgtgtggttgccgtcgaaggcgatccctatgtgttcaac
gtccatgttcacgacggtgctcccgccgacatcaccatcactttggaagatggttcaacc
gcagaggttacccaggttgaaaactggaccccaccccgtgaagttgatggcattacttgg
ggtgaagcttccttccagctgccgtccgaccttccactgggctggcacaccatcaccttg
acctccgacacgctaacgtcaagctgcttcctcatcgtgaccccggcgcgtctatctacc
gccgataagtacacagaaaatcctgtcagcggtgttatggcgcagctgtactctgctcgt
agtaagaattcttggggcatgggtgacttcaatgacctcggcctgctggctgagacgctt
gctcctcaggctgactatctgttgattaaccctctgcacgctgctgagccgatgccacct
gttgaggattccccgtacttgcctactacgcggcggtttatcaacccgatttatatccgc
attgaggatatccctgagcacttgcttctcgacgatgacctgcaagacgatatcgccgag
ctcgcggcagagttcacagcacttaatctcacccctaaaaagattgagcgcaatccaatt
tttgatgccaagttgcaggttctgcacgcggtattcaatgtagagcgcgaacctgcacgt
gaacaggacttccaggacttcatcgccaccgaaggccaaggcctacgcgacttcgcttcg
tggtgtgccgaccaagaactggtagttttggagagctccgcagcacatgccgctcttccg
gaaaaagaatctctgattcagttctacatgtggcagcagtggatttgcgatcaacagctt
ggtgctgctcaaacccgcgcaaccgacgctggaatgagcatcggtatcatcgccgatctc
gccgtgggcattcaccctgcgggtgccgatgcactttcgcttgccgacaccctagtcgcc
cgcgcttctgtgggtgcgccaccagatagctacaaccaccaaggccaagactggtctcag
ccaccatggcacccagaccgcttggctgagtcgggctatatcccttggcgtgacctgctg
cgcacggtgcttcgccacgccggtggtgtgcgtgtagaccacatccttggtcttttccgc
ttgttctggattccacgcacccagtccccacaaacgggtacttacgtcaactacgaccac
aacgcacttgtgggcgtacttgctttggaagcagagcgtgcaggcgcagtggttattggt
gaagacctcggtaccttcgagccatgggttcaagacttccttgcgtcccgaggcatcatg
ggcacctctgtgctgtggttcgaaagttccccagaaggtggcccacgcaagcagcacgag
taccgtcagttggcgctgacctcggtaaccacccatgatctgccaccaacagcgggctat
ctggcaggcgagcacattgcgttgcgtgaggaactcggaattttgaccaccgatgtagca
actgagtatgccgaggatttgaactggcaggcagacatcctcaatgtagttcgcaactcg
ggcgcatttgagtccatcgttcctgccgaattccacggtgtagatcgtgctgaccgcggc
agctccgtcgagctgctttcggcgttgcaccgcttcttggctggtacaccatcagctctg
acctgcaccgcattggtggatcttgtcgccgataagcgcgctcaaaaccagccgggcact
acttcggatcagtacccgaactggtgtattccgctatgcgacgagtccggcactccagtc
cttatcgaggacttggccgaaaaccccgtctatcaagcggtaacaaaggcgtcgactcgc
ctacattag

DBGET integrated database retrieval system