KEGG   Corynebacterium diphtheriae HC02: CDHC02_1885Help
Entry
CDHC02_1885       CDS       T01694                                 

Definition
(GenBank) putative dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
cde  Corynebacterium diphtheriae HC02
Pathway
cde00790  Folate biosynthesis
cde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cde00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CDHC02_1885
Enzymes [BR:cde01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     CDHC02_1885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: AEX77374
Position
complement(2023208..2024044)
Genome map
AA seq 278 aa AA seqDB search
MSAKDLIIPERTAVMGIVNVTEDSFSDGGRWLDIDAAIDHARDLVAAGADIIDVGGESTR
PGATRVDPDVERSRVIPVIRALSEEGIATSIDTMRASVAAAAANAGVKLINDVSGGLADR
AMYSVMADTQLPVCLMHWKTVRFGDAAGSADHGGDVVADVHQTLDKLVTSALNAGVKEDN
ITIDPGLGFAKTQEDNWALLRALPEFIAGPYPVLVGASRKRFLMAVRAARGLQSGPVDAD
PATAAVTAIAAHMGAWCVRVHEVAVSRDAVDVAALWNA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgaaagacctcatcattcccgagcgaacagccgtcatgggcattgtgaacgtc
actgaagattcattttccgacggtggccgctggctcgacattgatgccgcaatcgaccac
gcccgcgacctcgtcgcagcaggcgcagacatcatcgacgtcggtggcgaatccacccgc
ccaggtgccactcgcgtcgaccccgacgtggaacgcagccgcgtgatccccgtcatccgg
gcgctgtccgaagaaggcatcgccacctccatcgacaccatgcgcgccagcgttgcagcc
gcagcagccaacgccggcgtaaaactcatcaacgatgtttccggtgggctcgccgaccgc
gccatgtactccgtcatggccgacacccaactaccggtctgcctcatgcactggaagacc
gttcgcttcggggacgcagcaggaagcgccgaccacggcggcgacgttgtagcggacgta
caccagaccctagataagctggtcacctctgcactcaacgccggtgtcaaagaagacaac
atcaccatcgacccaggtctcggctttgccaaaacacaagaagataactgggcactctta
cgcgccctaccggaatttatcgcaggcccataccccgtgctcgtaggagcatcacgcaaa
cgcttcctgatggcagtccgcgccgcccgaggcctgcaatcagggccagtcgacgccgac
cccgccaccgcagcggtgacagcgatcgccgcacacatgggagcatggtgcgtgcgcgtc
cacgaagtagcagtttcccgagacgcggtcgacgttgcggccctgtggaatgcgtga

DBGET integrated database retrieval system