KEGG   Corynebacterium diphtheriae HC02: CDHC02_1885Help
Entry
CDHC02_1885       CDS       T01694                                 

Definition
putative dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cde  Corynebacterium diphtheriae HC02
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cde00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2023208..2024044)
Genome map
AA seq 278 aa AA seqDB search
MSAKDLIIPERTAVMGIVNVTEDSFSDGGRWLDIDAAIDHARDLVAAGADIIDVGGESTR
PGATRVDPDVERSRVIPVIRALSEEGIATSIDTMRASVAAAAANAGVKLINDVSGGLADR
AMYSVMADTQLPVCLMHWKTVRFGDAAGSADHGGDVVADVHQTLDKLVTSALNAGVKEDN
ITIDPGLGFAKTQEDNWALLRALPEFIAGPYPVLVGASRKRFLMAVRAARGLQSGPVDAD
PATAAVTAIAAHMGAWCVRVHEVAVSRDAVDVAALWNA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgaaagacctcatcattcccgagcgaacagccgtcatgggcattgtgaacgtc
actgaagattcattttccgacggtggccgctggctcgacattgatgccgcaatcgaccac
gcccgcgacctcgtcgcagcaggcgcagacatcatcgacgtcggtggcgaatccacccgc
ccaggtgccactcgcgtcgaccccgacgtggaacgcagccgcgtgatccccgtcatccgg
gcgctgtccgaagaaggcatcgccacctccatcgacaccatgcgcgccagcgttgcagcc
gcagcagccaacgccggcgtaaaactcatcaacgatgtttccggtgggctcgccgaccgc
gccatgtactccgtcatggccgacacccaactaccggtctgcctcatgcactggaagacc
gttcgcttcggggacgcagcaggaagcgccgaccacggcggcgacgttgtagcggacgta
caccagaccctagataagctggtcacctctgcactcaacgccggtgtcaaagaagacaac
atcaccatcgacccaggtctcggctttgccaaaacacaagaagataactgggcactctta
cgcgccctaccggaatttatcgcaggcccataccccgtgctcgtaggagcatcacgcaaa
cgcttcctgatggcagtccgcgccgcccgaggcctgcaatcagggccagtcgacgccgac
cccgccaccgcagcggtgacagcgatcgccgcacacatgggagcatggtgcgtgcgcgtc
cacgaagtagcagtttcccgagacgcggtcgacgttgcggccctgtggaatgcgtga

DBGET integrated database retrieval system