KEGG   Corynebacterium diphtheriae HC02: CDHC02_2010Help
Entry
CDHC02_2010       CDS       T01694                                 

Gene name
adhA
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cde  Corynebacterium diphtheriae HC02
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cde00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CDHC02_2010 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDHC02_2010 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    CDHC02_2010 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    CDHC02_2010 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CDHC02_2010 (adhA)
   00626 Naphthalene degradation
    CDHC02_2010 (adhA)
Enzymes [BR:cde01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CDHC02_2010 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2165375..2166415)
Genome map
AA seq 346 aa AA seqDB search
MSATEFPSAFTAAVVDKFGSELNIHDVDLPEPGQHQALVKVLTSGICHTDLHAAEGDWPV
KPKPPFVPGHEGVGEVVKLGPGEHSVALGDMVGNVWLWSACGECEYCRTGWETMCEKAEY
GGYTVDGSFGQYMLVDTRYCARIPDGCDLLEVAPILCAGVTVYKGLKVTETRPGQFVVIS
GVGGLGHIAVQYAVAMGMRVIAVDIADDKLELAKKHGAEFVVNAREEDPAEAIVKYTKGG
AHGVLVTAVHPQAFGQAIGMARKNGTIVFNGLPPGEFPAPIFDIVFKGLTIRGSLVGTRQ
DLEEALDFYARGMIKPTVTECKLDDVNSVFADMKQGKIDGRMAIRY
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctactgaattcccctctgccttcaccgccgctgttgtggacaagtttggctcc
gagctcaacattcacgacgttgacctcccagagccaggccaacaccaagcactggtcaag
gtgctcacctccggcatctgccacactgacctccacgccgccgaaggtgactggccagtc
aagccaaagccaccattcgtcccaggccatgagggcgtaggcgaagtggtcaaacttggc
ccaggtgagcacagtgttgcgctgggtgacatggtcggtaacgtctggctctggtcagcc
tgtggcgagtgcgagtactgtcgcaccggctgggagactatgtgcgagaaagccgagtac
ggtggatacaccgtcgatggttccttcggtcagtacatgctggtagacacccgttactgt
gcccgaatcccagacggctgtgacctgctggaagtcgccccaattctgtgcgctggcgtg
accgtgtacaaaggcctcaaggttaccgaaacccgcccaggccagttcgtggtcatctct
ggcgtgggtggtctgggccatatcgccgtccagtacgccgtggctatgggcatgcgcgtt
atcgccgtggatattgcggacgacaagctcgaactggctaagaagcatggcgctgagttt
gtggtcaatgcccgcgaagaagacccagctgaggcaattgtgaagtacaccaagggtggc
gcacatggcgtgctggtcaccgcggtgcacccacaggccttcggccaagcgattggcatg
gcccgtaagaacggaaccattgtgttcaatggtcttcctccaggagagttccctgcgccg
atcttcgacatcgttttcaagggccttaccattcgcggctcccttgtaggtacgcgccaa
gacctcgaagaggctttggacttctacgctcgcggcatgatcaagccaacggttactgaa
tgcaagcttgacgacgtcaactcggtctttgctgatatgaagcaaggcaagatcgacgga
cgcatggctatccgctactag

DBGET integrated database retrieval system