KEGG   Corynebacterium diphtheriae HC02: CDHC02_2058Help
Entry
CDHC02_2058       CDS       T01694                                 

Definition
putative secreted glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cde  Corynebacterium diphtheriae HC02
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cde00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CDHC02_2058
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    CDHC02_2058
Enzymes [BR:cde01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CDHC02_2058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2242477..2243628)
Genome map
AA seq 383 aa AA seqDB search
MDNLRRVFTPASLILGTVVAASMLSSCSQDSSQQAAPSTPSSTPTASQSEQPSSASSTPQ
AVALDPVQLRKDAASLMMVGVGNFDDALFAIQQGAGGIFIGSGTDPQILTTPGRDIAELR
RIAGRPLSVAIDFEGGRVLRHRGILGDFPSPQVMAQTMTPEQVRGMAYDMGRSLFAHGIN
VNFAPVVDIEAGLEVVGDRAFSPDPLIDATYATAFAQGMADAGVRPVLKHFPGHGRASGD
SHTAQVHTPPLAELEKLDLIPYGRVPVAGAGVMVGHMIVPGLGAPETPSTINPAAYQLLR
SGSYPGGQPFSGVIYTDDLTMGAVTSLMPTVQAVPAALAAGADQALWVSTAGLVEAIDAT
VAAISEGRYPVEQFKASVARVAG
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggataacctacgccgcgttttcacacccgcctcgctgattcttggcactgttgttgcc
gctagcatgctgagctcctgctcgcaggactcctcccaacaggctgcgccaagcactcct
tcatcaactcctactgcgtcgcagtctgaacagccctcgtcggcgtcgtcaacgccgcag
gctgttgctttagacccagtgcagctgcgcaaagatgctgccagcttgatgatggtgggc
gtgggtaatttcgacgatgctctctttgccatccagcaaggtgccggtggaatttttatc
ggctcgggaacggacccccagatcttgaccaccccaggccgcgacattgcggagctgcgt
cgaatagcaggtcgaccgctgtctgtagccatcgactttgagggtgggcgcgtgttgcgt
caccgcgggatccttggagatttcccatctccgcaggtgatggcgcaaaccatgacccca
gagcaggtgcgcggaatggcttatgacatgggtcgttccttgttcgcacatggcattaat
gtgaactttgcgccggtggtcgatattgaagccggccttgaagtagtaggcgatcgcgcg
tttagcccagatccgcttatcgacgccacctacgccaccgcattcgcccaaggtatggcg
gatgctggggtgcgtcccgtactcaagcacttcccagggcatggccgcgccagcggtgac
tcgcacaccgcacaagtacacaccccaccattggctgagctagaaaagctcgatctgatc
ccttatggccgagtgccggttgctggtgcgggcgtgatggttgggcacatgatcgtgcca
ggtttgggtgcgccagaaaccccatcgacgatcaaccctgccgcatatcagttgcttcgt
tccggttcgtatcccggtggtcaaccttttagtggcgtgatttacaccgatgatttgacc
atgggtgcggttacatcattaatgcccaccgtgcaggcggtaccagcagctctagcagcg
ggtgctgatcaggcactgtgggtaagtacagcgggcctggtcgaagccattgatgccact
gtggctgcaatctcggaggggcgttaccccgtcgaacagttcaaggcttcagttgcgcga
gtcgcaggctaa

DBGET integrated database retrieval system