KEGG   Corynebacterium diphtheriae HC02: CDHC02_2209Help
Entry
CDHC02_2209       CDS       T01694                                 

Definition
(GenBank) hypothetical protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
cde  Corynebacterium diphtheriae HC02
Pathway
cde00010  Glycolysis / Gluconeogenesis
cde01100  Metabolic pathways
cde01110  Biosynthesis of secondary metabolites
cde01120  Microbial metabolism in diverse environments
cde01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cde00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDHC02_2209
Enzymes [BR:cde01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     CDHC02_2209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AEX77696
Position
complement(2430430..2431215)
Genome map
AA seq 261 aa AA seqDB search
MVGRSNCGRAARAVGAILTRMSTVVDMPETRGHLISAITTASDPGEILYLSSRADFSEGG
SIRGGVPIIAPWFAKNLGHDELQHGWARRVEWETIPTNGGIDARTSHDDWDLRLGTQVLP
HGFAMMLKARNASPLRRDFQSAFHPYFRVADVRTTTVTVGDQEFRFDGTAVDQAVPLPEW
TPLVIKDSQRTITVTYQGADHAVVWNPGSELAAQMTDMGEGEWTEFVCVEPALLGDHAQG
ISVPPWDWAEIGMTVKVTPAQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtggttgggcgatcaaattgcggacgcgctgctcgtgccgtcggggctatccttacaaga
atgagcaccgttgtagatatgcctgagactcgcggacatttgatatctgcgattactacc
gccagcgatcctggcgagattctttacttatccagtcgcgcggatttttccgagggtggt
tcgatccgtggcggtgtcccgatcatcgcaccgtggtttgctaagaacttggggcacgat
gagttgcagcatggttgggcgcgccgggtggagtgggagacgatccctaccaatggcggt
atcgacgcccgcacgagccacgatgattgggatctgcgccttggtacgcaggtacttcct
catggttttgccatgatgttgaaggctcgcaacgcttccccactgcgtcgcgatttccaa
tccgcgtttcacccgtatttccgcgttgctgatgtacgcactaccaccgtaacggtgggc
gatcaggagtttcgtttcgacggcaccgccgtcgaccaagcggtccctctgccagagtgg
acgccgctggttattaaggattcccagcgcactattactgtcacctaccagggtgccgac
catgctgtggtgtggaatcctggcagcgagcttgccgcacagatgacagatatgggcgaa
ggcgaatggaccgagttcgtttgtgtagaaccagcattgttgggtgaccacgcccaaggt
atttccgttcccccttgggattgggcagagatcggcatgaccgtgaaggtcacaccggct
cagtaa

DBGET integrated database retrieval system