KEGG   Corynebacterium diphtheriae HC02: CDHC02_2219Help
Entry
CDHC02_2219       CDS       T01694                                 

Gene name
trpC1
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
cde  Corynebacterium diphtheriae HC02
Pathway
cde00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cde01100  Metabolic pathways
cde01110  Biosynthesis of secondary metabolites
cde01130  Biosynthesis of antibiotics
cde01230  Biosynthesis of amino acids
Module
cde_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cde00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CDHC02_2219 (trpC1)
Enzymes [BR:cde01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CDHC02_2219 (trpC1)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     CDHC02_2219 (trpC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI
Motif
Other DBs
NCBI-ProteinID: AEX77706
Position
2441232..2442689
Genome map
AA seq 485 aa AA seqDB search
MQNDSSTRPMPTVLESIVSGRRSHLPEIQARISHVDPARLPRSTRSLFHALGGHSDGGPA
LRGSTRFIMECKSSSPSLGMIREDYHPGDIARVYSRYAAGISVLCEPDRFGGDYNHLATV
AATTHLPVLCKDFIIHPAQVHAARYFGADAILLMLSVLDDATYTELSQEAARLGLDVLTE
VIDEVEVERAIRLGATIFGINHRNLHDLSIDLNRSARLAQLIPDSAVIVSESGIRNNETV
RQLSGHSSAFLVGSQLTSQPDVDRAARELVYGLNKVCGLQSPSEAQAARASGAIYGGLIF
VESSPRNVSRETSKKIMAAEPDLTYVAVSRRTTGWTEIIGGNIAVAQIHSPYQGSIAAEK
ELINHVRGEVGDKVKIWRAVSMTHADGSLVAEALAPEVDRLILDTGNGGTGTTFDWARIP
EAVKGKTLLAGGIGPDNVTEALAVGCAGLDLNSGLEYPVEAGKWAAHKDATAIHSTFTQI
RGFHY
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgcagaatgattcgtcgacacgccccatgcccaccgtcctagaatccatcgtttcgggc
cgacgatcccacctgcccgaaatccaagcgcggatttcccacgtggacccagcgcgacta
ccgcgttccacccgctccttgttccacgccttgggaggccatagcgatgggggtccggcg
ttgcgggggagtacgcgcttcatcatggagtgcaagtcctcctcgccgtcgcttggcatg
atccgcgaggactaccaccctggcgacatcgcgcgggtgtattcacgttatgcggccggc
atttcggtgttgtgcgagccggatcgttttggcggcgactataaccatctggccacggtg
gcggccacgacacatctgccggtgctgtgcaaggattttattatccaccccgcacaggtt
cacgcggcacgttattttggggcggacgcaattttgctcatgttgagtgtgcttgacgac
gccacctacaccgagctcagccaggaagcagcacgcttggggttggatgttctcaccgag
gttatcgacgaggttgaggtggaacgtgccattcggttgggggccacaatctttggcatt
aatcatcgcaatctgcatgacttgagcattgatttaaatcgctcagcacgccttgcgcag
ctgattcccgatagcgccgtgattgtctccgagtctggcattcggaataacgagacggtt
cgccaactcagcgggcattccagcgcattcttggtaggctcgcagcttacttctcagcca
gatgtggaccgtgcggcccgcgagcttgtgtacggcctcaataaggtgtgcggtttgcag
tcaccaagcgaggcgcaagcagcgcgcgcatcgggcgcaatctatggcggattaatcttc
gtggagtctagtccgcgtaatgtttcacgtgaaacatcgaaaaaaatcatggctgccgaa
cctgacctcacctatgtcgccgtctcacgacgcaccaccggatggaccgaaattataggt
ggcaacatcgccgttgctcagatccacagtccttaccagggctccatcgccgccgaaaaa
gaactcattaaccatgtgcgcggcgaggtaggagacaaggtaaaaatctggcgtgcagtc
tccatgacgcatgccgacggctcccttgtcgccgaagcactcgcacccgaggtagacaga
ctcatcctcgacaccggcaacggcggaaccggcaccaccttcgattgggcacgcatccca
gaagccgtaaagggcaagactcttctcgccggcggcattggaccagacaatgtcaccgag
gcactcgccgttggctgcgcgggactcgatctcaactccgggttggaatatccagtcgaa
gcagggaagtgggcagcacacaaagacgctactgcaatccactccactttcacccaaata
cgtggttttcattactaa

DBGET integrated database retrieval system