KEGG   Corynebacterium diphtheriae HC02: CDHC02_2224Help
Entry
CDHC02_2224       CDS       T01694                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cde  Corynebacterium diphtheriae HC02
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cde00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CDHC02_2224 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CDHC02_2224 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CDHC02_2224 (trpA)
Enzymes [BR:cde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CDHC02_2224 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2446342..2447178
Genome map
AA seq 278 aa AA seqDB search
MTRYTKLFSALSAKNEGAFVPFIMLGAPTPEASLAIIRTVVAAGADALELGVPFSDPVAD
GPTIQRSHLRALDNGATVDSSLELIRQIRKEFPELPIGMLIYGNVAFTRGITQFYQEFAD
AGVDSILLPDVPVREGEPFIAAAKQAGIDPIFIAPAQASEATLEGVAQHSSGYIYAISRD
GVTGTERQSSTRGLDKVVANVKRFGGAPILLGFGISTPEHVRDAIAAGASGAITGSALTS
IIERHTTGTHPEPAQVTDLEALIEEIFAFVKDMKAATR
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgactcgctacaccaaattattctccgcactcagcgccaaaaacgaaggtgcattcgtc
cccttcatcatgctgggtgctcccaccccagaggcgtcgttagcaatcatccgtaccgtc
gttgccgcgggtgccgacgccctcgaactcggcgtccccttctccgacccagtagcagac
ggccccacaatccaacgctcccacctccgtgccctcgacaacggagccaccgtcgatagc
tcgctggaactgatccgacagatccgcaaagaattccccgaacttcccatcggcatgctc
atctacggcaacgttgccttcacccgcgggatcacccagttctatcaagaattcgccgac
gccggcgtagactccatcctgcttcccgacgtccctgtccgcgaaggcgagcctttcatc
gcagccgccaagcaagctggaatcgaccccatcttcatcgcccccgcacaagcctcggaa
gcaaccttggaaggggtagcgcaacactccagcggatacatctacgctatctcccgcgat
ggtgtgaccggaaccgaacgccaatcctctactaggggactagacaaagtggtggcaaat
gtgaaacgtttcggcggcgcaccgatcctgctcggtttcggcatctccacacccgagcat
gtgcgcgacgccatcgcggcaggagccagcggcgccataacaggctccgcactgacgtcg
atcatcgagcggcacaccacaggcacgcacccagagccagcccaagtgacagaccttgag
gctctgatcgaagaaattttcgcgttcgttaaagatatgaaagccgcaacccgttaa

DBGET integrated database retrieval system