KEGG   Peptoclostridium difficile 630: CD630_00180Help
Entry
CD630_00180       CDS       T00487                                 

Gene name
recR
Definition
DNA repair and recombination protein
Orthology
K06187  
recombination protein RecR
Organism
cdf  Peptoclostridium difficile 630
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cdf00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CD630_00180 (recR)
DNA repair and recombination proteins [BR:cdf03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      CD630_00180 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
22529..23128
Genome map
AA seq 199 aa AA seqDB search
MQVYTGPITRLIEEFSKLPGVGRKTAQRLAFHIINMNTNDVEALSKAIIDAKREIRYCSI
CCNITDTDPCSMCSNKSRDSSVICVVEDPRDVAAMERTREFKGQYHVLNGVISPMDGIGP
DMLKIKELIQRLGNQEVKEIIMATNPTIEGEATAMYIARLVKPMGIKVTRIAHGLPVGGD
LEYADEVTISKALEGRREI
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtttatacaggtcccataacgagacttatagaggaattttcaaagcttcctgga
gtaggaagaaaaactgctcaaagattggcttttcatattattaatatgaatactaatgat
gtggaagctttatctaaagcgattatagatgcaaaaagagaaataagatattgctcaatt
tgttgtaatataacagatacagacccatgtagcatgtgttcaaataaaagtagagattca
agtgttatatgtgttgtggaagatccaagagatgtagcagctatggagagaacgagagag
tttaaaggacagtatcatgtattaaatggagtaatttctccaatggatggaattggacca
gatatgttaaaaataaaggaacttatccaaagacttggcaatcaggaagtcaaagaaata
ataatggcaacaaatcctactattgaaggtgaagctacagccatgtatattgctaggtta
gtaaaaccaatgggaatcaaagtcactcggatagctcatggtcttcctgttggaggcgat
ttagagtatgcagatgaggtcacaatatcaaaagcactagaaggcagaagagaaatataa

DBGET integrated database retrieval system