KEGG   Clostridium difficile 630: CD630_00450Help
Entry
CD630_00450       CDS       T00487                                 

Definition
sugar-phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
cdf  Clostridium difficile 630
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cdf00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CD630_00450
Enzymes [BR:cdf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     CD630_00450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
69685..70335
Genome map
AA seq 216 aa AA seqDB search
MLLEKLRKEVLQASLDLLNYNLVTLTGGNVSGRDEQTGYIAITPSGMDYRNLTPSDIVIV
DVDGNIIDGKWKASVDLSDHLYIYKHREDINSIIHTHSTYSSCFAILNEPIECASTTLAN
EVGGSVPVAKFSPPTSKKMGKCVIEAIGDKRACLLANHGVIAVGPSVGHALTAAVMLEDS
AKVYYLAKSIGTPVLLPDEEIQRARDVFFNVYGQDK
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgttattagagaaattaagaaaagaagtattacaagcatctttagaccttttaaactat
aatttagtgacattaacaggaggaaatgtaagtgggagagatgaacaaactggctatata
gcaatcaccccaagtggaatggattatagaaatcttacaccaagtgatattgttatagta
gatgtagatggaaatattatagatggaaaatggaaagcatcagtggatttatcagaccac
ttgtatatatataagcatagagaagacataaatagtataattcatacacattctacatac
tcaagttgttttgctattttaaatgaacctatagaatgcgcaagtacaactcttgcaaat
gaagtagggggttcagtaccagttgcaaaattttcgccaccaacatctaaaaagatggga
aaatgtgttattgaagcaattggtgacaaaagagcatgtcttttagcaaatcatggcgta
attgcagttggtccatctgtaggacatgctcttacagccgctgtaatgttagaagattca
gcaaaagtatattacttagcaaaatcaattggcacaccagtgctactgcctgatgaagaa
attcaaagagcgagagatgtattttttaatgtctatggtcaggataaataa

DBGET integrated database retrieval system