KEGG   Peptoclostridium difficile 630: CD630_01320Help
Entry
CD630_01320       CDS       T00487                                 

Definition
RecD/TraA type DNA helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cdf  Peptoclostridium difficile 630
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cdf00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CD630_01320
Enzymes [BR:cdf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CD630_01320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
177257..179476
Genome map
AA seq 739 aa AA seqDB search
MEKLEGMISEIVFKNEDNGYTIAHLVNENDEIVVVGCMPTLAIGESIEVEGKWVNHKIYG
TQFEVNSFMPVTPSSLEGIYVYLSSGMIHGIGEKMAKRIIDKFGVDTLEVIQNSPEKLQE
VEGIGSKKVKQIVKSYEEDRELRNIIIQLSPFGITPNYCLKIYKKYKSSAIEVINKNPYQ
LAEDIRGIGFKVADSIASKIGIDKNSKDRICQGILYTLNKSLSNGHTYLPEHVLIQDSEK
LLELNGEIIKECVMMLVYNQKIHIEKVNNENLIYLMPYYLAENGVCSQIVKLSQYEFEDL
KIDIDNEINVLEEDKKIKLAEKQILAVKESVNSGVLIITGGPGTGKTTTINAIIDIFENN
GKSVTLAAPTGRAAKRMSETSNKEAKTIHRLLEMGFSTDDDLTFFKDEEDPINSDVIIVD
EVSMVDIILMYNLLRAIKLGTRVILVGDSDQLPSVGAGNVLKDMINSNIINVVKLNEIFR
QAQESMIIVNAHKINNGEPLYLNTKGKDFFFIRKSTNEEILNEIIGLVNERLPKFYKVDK
LKDIQVLSSMRKGELGVTNLNIELQKYLNKKEKFKVEESFSKRLFRVGDKVMQVKNNYTK
KWETEDQKESGEGIYNGDIGYVYHIDKDKKTIYILFDQTKIVSYLYDELDEIDHSFCTTI
HKSQGSEFPVVVLPIAWAPPMLLSRNLLYTAVTRAKKLVVLVGDVKYLEYMIKNNRVNQR
YSNLGYKLNKFKQEGLLIE
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaattagaaggaatgataagtgaaatagtctttaaaaacgaagataatggttat
acaatagctcacctggtaaatgaaaatgatgaaattgtggttgtaggatgtatgcctact
ttggcaattggagaaagcatagaagttgaaggaaagtgggtaaatcataagatttatggg
actcaatttgaagtgaatagttttatgccagtaacaccatcatccttagaaggaatttat
gtttacttatcttctggaatgatacatggtattggtgaaaaaatggcaaaaagaataatt
gataagtttggtgtagatacgttagaggtgatacaaaattcaccagaaaaactacaagaa
gtagaaggtatagggagtaaaaaagtaaaacaaatagtaaaaagttatgaagaagacaga
gaattgagaaatataataatacagctatctccttttggaataacaccaaattactgccta
aaaatatataaaaaatataaaagcagtgcaatagaagttataaataaaaacccataccaa
cttgctgaagatataagaggaattggatttaaagtagctgatagtatagcaagtaaaatt
ggtatagataaaaactctaaagatagaatttgtcagggaatcttatacactttaaataaa
tctttaagtaatgggcatacatatttaccagagcatgttctaatacaagattcggaaaaa
ttattggagctaaatggagaaataataaaagagtgtgtaatgatgctagtttataatcaa
aaaatacatatagagaaagtaaacaatgaaaatcttatataccttatgccatactattta
gctgaaaatggagtatgtagtcaaatagtaaaattatcacagtatgaatttgaagactta
aaaatagatatagataacgagattaatgttttagaagaagataagaaaattaagttagca
gaaaaacaaattttagcagtcaaagaatctgttaatagtggagtattaattataactggt
ggaccaggaactggtaaaacaactaccattaatgctatcatagatatatttgaaaataat
ggtaaaagtgtgactttggcagctccaacgggaagagcagcaaagagaatgagtgaaact
tctaataaagaagcaaaaactatacataggttgctagaaatgggattttcaacagatgat
gatttaactttttttaaggatgaagaagacccaataaattcagatgtaataattgttgat
gaggtatcaatggtagacattatcttaatgtacaatttacttagagctataaagttagga
acaagagtaattttagttggagatagtgaccaattaccttctgtaggtgctggaaatgta
cttaaggatatgattaattctaatattataaatgtagttaaattaaatgaaatatttaga
caagcgcaagaaagtatgataattgtaaatgcccataagataaacaatggagaaccactt
tatctaaatacaaaaggtaaagatttcttttttataagaaaatcaactaatgaagaaatt
ttaaatgaaataataggattggttaatgaaagattacctaaattttataaagttgataaa
ttaaaagatatacaagttttatcttcaatgagaaaaggtgaattgggagttactaatctc
aatatagagttacagaagtatcttaacaaaaaagaaaaatttaaagttgaagaaagtttt
tctaaaagattatttagagttggcgataaggtaatgcaagtaaaaaataattatacaaaa
aaatgggaaacagaagaccaaaaagaaagtggagaaggtatctataatggagatatagga
tatgtttatcacatagataaagataagaaaactatttatatattatttgaccagactaaa
attgtatcatacctatatgatgaattagatgaaattgaccatagtttttgtacaacaata
cataaaagccagggaagtgaatttccagttgtagtattgccaatagcgtgggctcctcct
atgttacttagccgtaatttattatatacagcagtaacaagagcaaaaaaattagttgta
ttagttggagatgtgaaatatcttgaatatatgataaaaaataatagagttaatcaaagg
tattcaaatttaggatataagctaaataaatttaaacaagaagggttgttgatagaataa

DBGET integrated database retrieval system