KEGG   Peptoclostridium difficile 630: CD630_02990Help
Entry
CD630_02990       CDS       T00487                                 

Gene name
rbsK
Definition
PfkB family ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cdf  Peptoclostridium difficile 630
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cdf00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CD630_02990 (rbsK)
Enzymes [BR:cdf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CD630_02990 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
360146..361036
Genome map
AA seq 296 aa AA seqDB search
MGNIVVIGSVNMDMVCSVDKRPEKGETVLGNSFFTSPGGKGANQAISASKLGANVKMISC
IGEDGLGEELIRNFRTNKVDYSLVSRNNHKSSGVAVITLCENDNSIVVVPGTNELVDIEL
IKKNEEEIKNADIVLLQLEIPLKTINYVVNFCFENRIRVLLNPAPAVKLNEDIIEKVTYL
TPNEHEYKIVFDTNEGIEEVLKKYPNKLVITEGKNGARFYDGEEIKHVSCISVDVQDTTG
AGDTFNGALAVAITEGQNLYTAVEYAVVVSGLSVTKLGAQSGMPYKEDVEKYLNNK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacatagttgtcataggaagtgtaaacatggacatggtatgttctgtagataaa
agaccagaaaaaggagaaacagtattaggtaatagtttttttacatcacctggaggaaaa
ggggctaatcaagctatctcagcttctaaactaggagcaaatgtaaaaatgatatcatgc
ataggggaagatggcttaggagaggagttaataagaaattttagaacgaataaagttgat
tatagcttagtatccagaaataatcacaaaagttctggtgttgctgttataacattatgt
gaaaatgataatagtattgttgttgtaccagggactaatgagctagtagatatagaatta
attaaaaagaatgaagaagagataaagaatgcagatatagtattgctacaattagagatt
ccattaaaaacaataaattatgtagtgaatttctgttttgaaaataggattagggtttta
ttaaatccagcaccagcagtaaaactaaatgaagatataatagaaaaagtaacttactta
acaccaaatgaacatgaatataagatagtttttgacacaaatgaagggatagaagaagta
ttaaaaaaatatccaaataaacttgtaataacagaaggaaaaaatggagctagattttat
gatggtgaggaaatcaagcatgtatcttgtataagtgttgatgttcaagataccacagga
gcaggagatacatttaatggagcattggcagtggctataacagaagggcaaaatttatat
acagcagtagaatatgcagtagtagtatcaggtctttctgtaactaaactaggtgcacaa
tctggtatgccatataaagaagatgttgaaaaatatttaaataataaataa

DBGET integrated database retrieval system