KEGG   Clostridioides difficile 630: CD630_03340Help
Entry
CD630_03340       CDS       T00487                                 

Gene name
adhE
Definition
(RefSeq) bifunctional acetaldehyde-CoA/alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
cdf  Clostridioides difficile 630
Pathway
cdf00010  Glycolysis / Gluconeogenesis
cdf00071  Fatty acid degradation
cdf00350  Tyrosine metabolism
cdf00620  Pyruvate metabolism
cdf00625  Chloroalkane and chloroalkene degradation
cdf00626  Naphthalene degradation
cdf00650  Butanoate metabolism
cdf01100  Metabolic pathways
cdf01110  Biosynthesis of secondary metabolites
cdf01120  Microbial metabolism in diverse environments
cdf01130  Biosynthesis of antibiotics
cdf01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cdf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD630_03340 (adhE)
   00620 Pyruvate metabolism
    CD630_03340 (adhE)
   00650 Butanoate metabolism
    CD630_03340 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    CD630_03340 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    CD630_03340 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CD630_03340 (adhE)
   00626 Naphthalene degradation
    CD630_03340 (adhE)
Enzymes [BR:cdf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CD630_03340 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     CD630_03340 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-GeneID: 4915990
NCBI-ProteinID: YP_001086803
UniProt: Q18D77
Position
404609..407251
Genome map
AA seq 880 aa AA seqDB search
MEKKEKVVEKSNVEVCSPEIVNSVETLRMRLEEIRLAQKEFATFTQEQVDKIFLAASTAA
NQQRIPLAKMAVEETGMGIVEDKVIKNHFASEYIYNAYKDTKTCGVIEKDEAFGFTRIAE
PVGVLSAVIPTTNPTSTAIFKSLIALKTRNGIIFSPHPRAKNCTIEAARVVHDAAVKAGA
PKGLIGWVDVPSIELTNVVMAEADLILATGGPGMVKSAYSSGKPAVGVGPGNVPAIIDES
ADIKMAVSSILVSKSFDNGMICASEQAVIVPEKIYEEVKKEFKYRGAHFLNKEETEKVGK
VVIIDGSLNARIVGQPAHVIAKMADVEVPKTARIIIGEVESVELNEPFAHEKLSPVLAMY
KSKSFEDAVAKAEKLVADGGYGHTSSLYADSINHPERVEKFVNAMKTCRVLVNTPSSQGG
IGDLYNFKLAPSLTLGCGSWGGNSVSENVGVKHLLNIKTVAERRENMLWFRAPEKVYFKK
GCLGVAAREFKDVMDKKKAFIVTDSFLYNNGYTKKLTDLLDEMGIKHTTFFDVAPDPTLA
CAREGAKAMADFQPDLIIAVGGGSAMDAGKIMWVMYEHPEVDFQDLAMRFMDIRKRVYVF
PKMGEKAYFAAIPTSAGTGSEVTPFAVITDQDSGVKYPLADYELMPNMAIIDADMMMEMP
PRLTAASGVDALTHALEAYVSMLRTEPADGLALQAGKIIFEYLPRAYKNGKNDKEAREKM
AMASTMAGMSFANAFLGICHSLAHKLGAFHHVQHGVANALLINEVIKFNCAEAPNKMGAF
SQYRYPDCIQRYAEFASFAGIKGSTDQEKVDNLIKAIDELKAKVGLPKTIKEAGVEESKF
LERLDAMVEQAFDDQCTGANPRYPLMSELKEIYLKVYYGK
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaaaagaaaaggtagtagaaaaatcaaatgttgaagtatgtagtcctgaaatt
gtcaacagtgttgaaacattaagaatgagattagaagaaattagattggcacaaaaagaa
tttgcaacatttacgcaagaacaggtagataagattttcttagctgcttcaactgcagct
aatcaacaaagaatacctctagcaaaaatggcagtggaagagactggtatgggtattgtt
gaagataaggttataaaaaaccattttgcctcagaatatatctataatgcttataaagat
actaaaacttgtggtgtcatagaaaaagatgaagcatttggttttacaagaattgctgag
ccagtaggtgttttatcagcagttataccaacaactaatcctacatcaactgcaatattc
aaatccctaatagcactaaaaactagaaatggtataattttctctcctcatccaagagct
aaaaactgtactatagaagcagctagagttgtacatgatgcagcagttaaggcaggagca
ccaaaaggacttataggttgggtagatgttccttcgattgaattaactaatgttgtcatg
gcagaggcagaccttatattagctactggtggacctggaatggttaaatctgcatactct
tcaggtaaaccagctgtcggagttgggcctggaaatgtacctgcaataatagatgagagt
gcagatataaaaatggctgtaagttcaatcttagtatcaaaatcattcgataatggtatg
atatgtgcttccgagcaagctgtaatagtaccagaaaaaatatatgaagaagttaaaaaa
gaatttaaatatcgtggagcacatttcctaaataaagaagaaactgaaaaagtaggaaaa
gtagtaataattgatggttcattaaatgccagaatagttggacaaccagcacatgtaata
gccaaaatggcggatgtagaagttccaaaaacagctagaataataattggtgaagtagaa
tctgttgaattaaatgaaccttttgcacatgaaaaactttctcctgtacttgcaatgtac
aagtctaaaagttttgaagatgcagttgctaaagcagaaaaattagttgcagatggaggc
tatggtcatacatcttcattatatgcagactctataaatcatccagagagagtagaaaag
tttgtaaatgctatgaagacttgtagagtattagttaatactccatcatcacaaggtggt
ataggtgatttatataactttaaattggcaccgtctcttactcttggttgtggttcttgg
ggtggaaactcagtatctgaaaacgttggagtaaaacatttgcttaatatcaagacagta
gctgaaaggagagagaatatgctttggttcagagcaccagaaaaggtttatttcaaaaaa
ggatgtttaggtgtagcagcaagagaatttaaggatgttatggataaaaagaaagcattt
atagtaacagattctttcctatataataatggatatactaagaaattaactgatttatta
gatgagatgggaattaagcatactacattctttgatgtagctccagacccaacattagct
tgtgcaagagaaggagctaaagctatggctgatttccaaccagatttaataatagctgta
ggtggaggaagtgcaatggatgctggtaagataatgtgggtaatgtatgagcatccagaa
gtagatttccaagacttagctatgagatttatggatataagaaaaagagtatatgtattt
cctaagatgggtgaaaaagcgtattttgctgctatcccaacttcagcaggaactggttca
gaagtaactccatttgcagttataactgaccaagattcaggtgtaaagtacccattagca
gattatgaattaatgccaaacatggctataattgatgctgatatgatgatggagatgcca
ccaagattaacagcagcatcaggtgttgatgctttaacacatgcattagaagcatatgta
tctatgttaagaactgaaccagctgacggtctagcactacaagcaggtaaaataatattt
gaatatttacctcgtgcatataaaaatggaaagaatgataaagaagcaagagaaaaaatg
gcaatggcatctactatggcaggaatgtcttttgcaaatgccttcttagggatatgtcac
tctttagcacataaattaggtgcattccaccatgttcaacacggtgttgcaaatgcatta
ttaataaatgaagtaatcaagttcaattgtgcagaagctccaaataaaatgggtgcattc
tcacaatacagatatcctgattgcatacaaagatatgctgaatttgcttcttttgcaggt
attaaaggaagtacagaccaagaaaaagtagataatcttataaaagcaatagatgaacta
aaggcaaaagtaggtcttcctaagactataaaagaggctggagtagaagaatctaaattc
ttagaaagattggatgctatggttgaacaagcttttgatgaccaatgtacaggtgctaat
cctagatacccattgatgagtgaattaaaagagatatatctaaaagtttattatggtaaa
taa

DBGET integrated database retrieval system