KEGG   Clostridioides difficile 630: CD630_03890Help
Entry
CD630_03890       CDS       T00487                                 

Gene name
bglA
Definition
(RefSeq) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
cdf  Clostridioides difficile 630
Pathway
cdf00010  Glycolysis / Gluconeogenesis
cdf00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:cdf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD630_03890 (bglA)
   00500 Starch and sucrose metabolism
    CD630_03890 (bglA)
Enzymes [BR:cdf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     CD630_03890 (bglA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-GeneID: 4915657
NCBI-ProteinID: YP_001086855
UniProt: Q18DC7
Position
459275..460741
Genome map
AA seq 488 aa AA seqDB search
MRKFPEGFLWGGATAANQFEGGWNLGGKGWSVSDVAKAHFDADVKDYKSNNEITTKDIEE
GLAHPEDEVNYPKRHGSDFYHHYKEDIALMAEMGFKTYRMSIAWSRIFPNGDDKEPNEEG
LQFYDDVFDELISYGIEPLVTMSHYEPPLNIVLNYDGWYSRQVINMFVRYVETICERYKN
KVKYWLTFNEVDSMIRHPYTTGGLVRDRFKDKNFEEVIFQAMHHQFVASALATKICHEII
PNSKVGCMLTKLTYYPYTCRPEDVLATQQKMRSIYAYSDTQVFGEYPVYLLSYFKNNNIQ
IVKEEHDDEIMKKYPVDFISFSYYMSSCEAADTTGLDITPGNTLLAVKNPYLEMSEWGWQ
IDSIGLRISLIELYDRYRKPLFIVENGLGAKDILTEDKKVHDQYRINYLKEHFKCMLDAI
IEDGVELWGYTSWGCIDLVSESTKQMSKRYGYIYVDADDYGKGTYNRYKKDSFYWYKKVI
ENNSIDFK
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagtttccagaaggatttctttggggaggagctacagctgctaatcaatttgaa
ggtggttggaatttaggtggtaaagggtggtctgtatcagatgtagcaaaggcacacttt
gatgcagatgtgaaagattataaatctaataatgaaatcacaacaaaagatatagaagaa
ggattagcacatcctgaagatgaagtaaattatccaaaacgtcatggtagtgatttttat
catcactataaagaagatattgctctaatggcagaaatgggatttaagacatatcgaatg
agtattgcttggtctcgtatttttccaaatggagatgataaagagccaaatgaagaaggt
ttacagttttatgatgatgtatttgatgagttgataagttatggaattgaaccacttgtt
actatgtcacattatgaaccaccattaaatatcgttttaaactatgatggatggtattca
cgacaagttatcaatatgtttgttaggtatgtagaaactatctgtgaaagatataaaaac
aaagtgaaatattggcttacatttaatgaagttgattctatgattcgtcatccgtacact
actggtggtttagttcgagaccgttttaaggataaaaactttgaggaagttatttttcaa
gctatgcatcatcaatttgtagctagtgcccttgcaacaaaaatttgtcatgagattatt
ccaaattcaaaagtagggtgtatgttaacaaaattaacgtattatccatatacatgtaga
ccagaagatgttttggcaactcaacaaaaaatgagaagtatttatgcatatagtgatacg
caggtttttggtgagtatccagtatatttactgtcgtattttaaaaataataacattcaa
atagtaaaagaagaacatgatgatgaaattatgaaaaagtatccagtagattttatttca
ttctcttactatatgtcttcttgtgaggcagctgatacaactggattagatattacacct
gggaatacgttattagctgtaaaaaatccttatttagaaatgagtgaatggggttggcaa
attgattcaataggtctacgtatatctttgattgaattatatgatagatacagaaagcct
ttatttatagttgaaaatggattaggagctaaagatattttaactgaagataaaaaagtt
catgaccaatatagaattaattatttaaaagaacactttaaatgtatgttagatgcgatt
attgaagatggtgttgaactttggggatatacttcatggggttgtattgatttggtcagt
gaatcaacgaaacaaatgtcaaaacgttatggatatatttatgtggatgctgatgactat
ggaaaggggacatataatcgatataagaaagatagtttttattggtataaaaaggtaatt
gaaaataatagtatagattttaaatga

DBGET integrated database retrieval system