KEGG   Clostridium difficile 630: CD630_05420Help
Entry
CD630_05420       CDS       T00487                                 

Definition
protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
cdf  Clostridium difficile 630
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:cdf02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:cdf02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
647386..647982
Genome map
AA seq 198 aa AA seqDB search
MERFNNMVIAIGASVGGTEAILEIIKDLPKSTPGIVVVQHMPAIFTYMYAQRLDKQCIMN
VREAKNNDRVEQGNVLIAPGGYQMKLCTDKQGYYVTCEKGERISGHCPSVDVLFDSVAEV
AGKNSIGIILTGMGYDGANGLLKMKENGSFTIGQDENSCIVYGMPMVAFDRGSVMLQLPL
GEISNCLIRHINILKQKD
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtggaacgttttaataatatggttattgctataggcgcatctgtaggtggtacagaagca
atacttgaaattataaaagacctaccaaaatcaacaccagggattgttgtagttcaacat
atgccagctatatttacttatatgtatgcacaacggcttgacaagcagtgtattatgaat
gtaagagaagctaagaataatgatagagtagaacaaggaaatgtgttaattgcacctggg
ggttaccagatgaaattgtgtacggataaacaaggatattatgtaacttgtgaaaaggga
gaaagaataagtggtcactgtccatcagtagacgttttgtttgattcagtagcagaagta
gcaggtaaaaattcaataggaataatacttacaggtatgggttatgatggagcaaatgga
cttttaaaaatgaaagaaaatggttcatttacaattggacaggatgaaaattcttgtata
gtatatggaatgccaatggtagcttttgatagaggttctgttatgttacaattacctctt
ggtgaaatttcaaactgtttgataagacatattaatattttaaaacaaaaagattaa

DBGET integrated database retrieval system