KEGG   Peptoclostridium difficile 630: CD630_07410Help
Entry
CD630_07410       CDS       T00487                                 

Gene name
glpK1
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cdf  Peptoclostridium difficile 630
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdf00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    CD630_07410 (glpK1)
Enzymes [BR:cdf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     CD630_07410 (glpK1)
Exosome [BR:cdf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CD630_07410 (glpK1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
903936..905462
Genome map
AA seq 508 aa AA seqDB search
MKYVLAIDQGTTGTRAVLINEKSEFVFSDYMEHTQIYPQSGYVEHDPIEIWNNTKTVSNN
VLQQAFENGINESDIKGIGIDNQGETVMLWDKNTGKPLYNAIVWQCRRTYDYVENLKNIP
GLENKIIDKTGLIIDPYFSGTKIKWVIDNVKGVKEKIKNGEVLAGTLDSWLIWKMTGGKS
FLTDVSTAARTMLFNIRDMDWDRELLDIIGVPRSILADIMPTSGDFGTTDKEAFCGVSIK
ITASMVDQPAALFGNGCFEPGMVKNTYGTGCFLYMNIGEELNIAGNGILTTVAWKIGDKV
TYAYDGGVYIAGAAIQWLRDGIGVIKNYSETDDMANSISSTGGVYFVPAFAGIAAPYWDQ
YARGTMVGITGSTKKEHIVRATLESVALQVKDVVDSMNLASGKKIKMLRVDGGITKNNFT
MQFQSDILGIPIEIAENPETTVLGVGYMAGLSCGVWNSIDEIRSEFTISKKYIPNMTTQK
REEILLGWNQAVKRAMNWENDTKKVCAN
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatatgtattagcaattgaccaaggaacaacaggaacaagagcagtattgataaac
gaaaaatcagagtttgtttttagcgattatatggaacatactcaaatatatccacaatct
ggatatgttgaacatgaccctatagaaatttggaataatacaaaaactgtgagtaataat
gtattacaacaagcttttgaaaatggaatcaatgaaagtgatataaaaggaattggtata
gataatcaaggtgaaacagtaatgttatgggataaaaatacaggtaaaccactttacaat
gctattgtgtggcagtgcaggagaacttatgattatgtggaaaatttaaagaatatacca
ggtttagaaaataagataatagataagactgggttaattatagacccatatttctcaggt
acaaaaattaaatgggtaatagataatgtaaaaggtgtaaaagaaaaaattaaaaatgga
gaagtacttgcaggaacattagatagttggttaatatggaaaatgacaggaggaaaatct
tttttaactgatgtatctacagcagcaagaacaatgctttttaatataagagatatggat
tgggatagagagttgcttgacattataggagtacctagaagtattttagcagatataatg
cctacgagtggtgattttggaactacagataaggaggcattttgtggggtttctataaaa
attactgcttcaatggtagaccaaccagcagctttatttggcaatggatgttttgaacca
ggaatggttaaaaatacttatggtacaggatgtttcctatatatgaatataggtgaggaa
ctaaatatagcaggtaatggtattttgacaactgttgcttggaaaataggagataaggtt
acatatgcttatgatggtggagtgtatatagcaggtgctgcaatacaatggcttagagat
ggcattggagttataaaaaattattcagaaactgatgacatggcaaattccatatcaagt
actggaggtgtatattttgtaccagcatttgcaggtatagcagcaccttattgggaccaa
tatgctagaggtacaatggttgggataacaggaagtactaaaaaagagcatatagtaaga
gcgactcttgagtctgttgcacttcaagtcaaagatgttgttgattctatgaacttagcc
tcagggaaaaaaataaaaatgttgagagtagatggtggaattactaaaaataactttaca
atgcaatttcaatccgacatattaggcataccaattgaaattgcagaaaatcctgagacg
acagtacttggagtaggatatatggcaggtctttcttgtggtgtctggaacagtattgat
gaaattagaagtgaatttacaataagcaaaaaatatattccaaatatgactactcaaaaa
agagaagaaatattacttggatggaaccaagcagtaaaaagagctatgaattgggaaaac
gataccaaaaaggtgtgtgctaattaa

DBGET integrated database retrieval system