KEGG   Clostridium difficile 630: CD630_08180Help
Entry
CD630_08180       CDS       T00487                                 

Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
cdf  Clostridium difficile 630
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cdf00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
992746..994152
Genome map
AA seq 468 aa AA seqDB search
MNTGFPKDFLWGASSSAFQVEGAWDKDNKGKTVADYNSFKKSHLQADTKVASDFYHNYEE
DIELMKELGMKTYRFSISWARIIPDGEGEINQKGLDFYNKIIDKLIECDIEPFVTLYHFD
LPFKLVEKYNGWESRETVYAFERFAKICFKHFGDRVKYWQPHNEQNLIVRVEERINIYDE
TDSWKIDKIRAQMDYNLCLAHALAVNACHEMIKESKIGAAVSSSVTYPLTSKPEDVYAAR
MNDNFKVYYMLDMHHYGEYPGYYMKYLEKRNIVPHMEDGDKEILKKAKMDFIAVNYYRTN
CAEALPEDSQHPFGLREGTVDFSMYGLFKMSMNPNLEASEYGAAIDPSGLRVALNEYWQR
YHLPVIITENGLGAKDILEDGKIHDDYRIDYLRSHINACKLAIEDGVEMIGYCPWSFTDL
LSSSQGFNKRYGLVYINRTDHEVLDLKRIKKDSFYWYKEVIENNGIVK
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgaatacaggatttccaaaagactttttatggggagcatcatcttctgcatttcaagtg
gaaggagcttgggataaagacaataaaggaaaaaccgtagccgactataattcttttaaa
aaatctcatttacaggcagatactaaagtcgcatcagacttttaccataattatgaagaa
gatattgaattaatgaaagaattagggatgaaaacatatcgtttttcaatttcatgggca
agaataataccagatggtgaaggagagataaaccagaaaggtttagacttttataataag
ataatagacaaactaatagagtgtgatattgagccattcgtaactttataccattttgac
cttccatttaaattagtagagaaatataatggttgggaaagtagagaaactgtctatgct
tttgaaagatttgctaaaatatgctttaagcattttggagatagggtaaagtattggcaa
cctcataatgaacagaatttaattgttagagtggaggagagaattaatatatatgatgaa
acagattcatggaagatagataaaatacgtgctcagatggattataatctttgcttagca
catgcattagcagtcaatgcatgtcatgagatgataaaagaaagtaaaattggagcagca
gtatcatcatctgtaacatatcctcttacttctaagccagaagatgtatatgcagctaga
atgaatgataattttaaagtgtactatatgcttgatatgcatcattatggagaatatcca
gggtattatatgaagtatcttgaaaaaagaaatatagttcctcacatggaagatggggat
aaagagatacttaaaaaagctaaaatggattttatagctgtaaattattataggacaaat
tgtgcagaagctttacctgaagattcacaacatccatttggattaagagaaggaactgtt
gattttagtatgtatggactatttaaaatgtcaatgaatcctaacttagaggcttctgag
tatggagcagcaatagacccatcaggtcttagagttgccttaaatgaatattggcaaaga
tatcacttacctgttataataacagaaaatggtctaggagctaaagatatattagaagat
ggaaaaattcatgatgactatcgtatagactatttaagaagtcatataaatgcatgtaaa
ctagctattgaagatggtgtagagatgattggatattgtccatggtcatttacagacctt
ttaagttcttctcaaggttttaataagcgttatggacttgtttatataaatagaactgac
catgaagttttagatttaaaaagaatcaagaaagatagtttttactggtataaagaagtt
atagagaacaatggaatagtaaaataa

DBGET integrated database retrieval system