KEGG   Peptoclostridium difficile 630: CD630_08910Help
Entry
CD630_08910       CDS       T00487                                 

Gene name
speB
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cdf  Peptoclostridium difficile 630
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:cdf00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CD630_08910 (speB)
Enzymes [BR:cdf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     CD630_08910 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1072917..1073795
Genome map
AA seq 292 aa AA seqDB search
MKNNFYHMNTFMSMDKNYEESNLIVFGVGFDGTTSNRPGARFASSSMRKEFYGLETYSPF
LDLDLEDYNICDYGDLEISVGSTEQVLKEIYQETYKIVRDSKVPFMIGGEHLVTLPAFKA
VHEKYNDIYVIHFDAHTDLREEYNNSKNSHATVIKRIWDIVGDNKIFQFGIRSGTKEEFK
FATEEKHTYMEIGGIDTFENIVNMLNGKNIYLTIDLDVLDASVFPGTGTPEPGGVNYREF
QEIFKIIKNSNINIVGCDIVELSPDYDTTGVSTVIACKILRELCLIISDKIK
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaagaataatttctatcatatgaacacttttatgagtatggacaaaaattatgaagaa
tctaatcttatagtatttggtgttggatttgatggaactacttctaacagacctggggct
agatttgcaagtagctctatgagaaaagaattttacggtcttgagacatacagtcctttt
ttagatttggatttagaggattataatatatgtgattatggagatttagaaattagtgtt
ggaagtacagaacaagtcttaaaagaaatctatcaagagacatataagattgttagagat
tcaaaggtaccctttatgattggaggagagcatttagttacattaccagcctttaaagca
gtacatgaaaagtacaatgatatatatgtaattcattttgatgcccatactgatttgagg
gaagaatataataatagtaaaaattctcatgcaacagtaattaaaagaatatgggatatt
gtaggtgataataaaatatttcaatttggtataaggtctgggacaaaagaagaatttaaa
tttgctacagaagaaaaacacacatacatggaaataggaggaatagatacatttgaaaat
atagttaacatgctaaatggaaagaatatttatctaactatagatttagatgtattggat
gcatctgtgtttccaggaacaggtacaccagaacctggtggtgtaaattatagagagttt
caagagatttttaagattataaaaaactctaatataaatatagttggttgtgacattgta
gagttaagccctgattacgatacaacaggtgtatcgacagttatagcttgtaaaatccta
agagagttatgcttaataatatctgataaaattaaatag

DBGET integrated database retrieval system