KEGG   Clostridioides difficile 630: CD630_14500Help
Entry
CD630_14500       CDS       T00487                                 

Gene name
folP
Definition
(RefSeq) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
cdf  Clostridioides difficile 630
Pathway
cdf00790  Folate biosynthesis
cdf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CD630_14500 (folP)
Enzymes [BR:cdf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     CD630_14500 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind CdhD DUF1699
Motif
Other DBs
NCBI-GeneID: 4915722
NCBI-ProteinID: YP_001087951
UniProt: Q18BX0
Position
1680199..1681002
Genome map
AA seq 267 aa AA seqDB search
MSLIVFDYGKRTYIMGILNVTPDSFSDGGDFNNLDIAIQHAKDMVDQGADIIDLGGESTR
PGHSYVDSDEELRRVIPVIKKLKQELDIPISIDTYKADVAEEALKLGVTMVNDVWGLRKD
KNMASVIGKYDAEVCIMHNQDGTNYDKDIMESIKDFFKVSIEMAMSCGVKKEKIVLDPGV
GFGKDFEQNIEVLRRLNELKDLGYPILLGTSRKSVIGKVLPVEPKKRLEGTIATTVLGIR
DGVDIVRVHDVYENLMAARMTDAIYRK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgtcattaattgtgtttgattatggtaaaagaacttatataatgggaatattaaatgta
actccagatagtttttctgatggaggagattttaataacttggacatagcaatacaacat
gcaaaagatatggttgaccaaggtgcagatataatagacctaggaggagagtctacacgc
ccaggtcatagctatgtagactcagacgaagagctaagaagagtaatccctgtaataaaa
aaacttaaacaggaattggatataccaatatcaatagacacttataaggcagatgttgca
gaagaagcattaaaattaggtgtcactatggtaaatgatgtttggggtcttagaaaagat
aaaaatatggcttctgtaataggaaaatatgatgcagaagtgtgtataatgcataatcaa
gatgggacaaactatgacaaagatataatggagtcaataaaagacttttttaaggtaagt
atagaaatggcaatgagttgtggtgtaaaaaaagaaaaaatagtacttgacccaggtgta
ggatttggcaaggattttgaacaaaatattgaagtattgagaagattaaatgaattaaaa
gatttagggtatcctattttgcttgggacatccagaaaatcagtaataggaaaagtactt
ccagttgagcctaaaaaaagattagaaggtacaatagctactactgttcttggtataaga
gatggcgtagatatagttagagtacatgatgtttatgaaaatttaatggcagctagaatg
actgatgcaatatatagaaagtag

DBGET integrated database retrieval system