KEGG   Peptoclostridium difficile 630: CD630_14520Help
Entry
CD630_14520       CDS       T00487                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cdf  Peptoclostridium difficile 630
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CD630_14520 (folK)
Enzymes [BR:cdf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     CD630_14520 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1681371..1681877
Genome map
AA seq 168 aa AA seqDB search
MNKAYLGIGTNMGDRFDNLSRACELLKNSDSIYKVKESSLYETKPWGYTEQADFLNMCVE
IETEFEPYELLEYCQEIERELHRERIVHWGPRTIDVDVLFFNDVVSTDERLTIPHPRIQD
RAFVLIPLMDLNEELIINEKTIKEHLNLLSAEEREEVKELVGYERKPI
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgaataaggcttatttgggaataggtactaacatgggtgatagatttgataatttatca
agagcatgtgaacttttgaaaaatagtgattctatatataaagtaaaagaatcaagctta
tacgaaacaaaaccatggggatatacagaacaagcagattttctaaatatgtgtgtagaa
atagaaacagagtttgaaccttatgagttgttagaatattgtcaagaaatagagagagaa
ctacatagagagagaatagttcattggggaccaagaactatagatgtagacgtactattt
tttaatgatgtagtttccactgatgaaagactaacaatacctcatccaaggattcaagat
agagctttcgttttgataccacttatggatttaaatgaagaacttataataaatgaaaaa
acaataaaagaacatttaaacctcctatctgctgaagaaagagaagaagtaaaggagctt
gtaggttatgaaagaaaacctatttaa

DBGET integrated database retrieval system