KEGG   Clostridioides difficile 630: CD630_21300Help
Entry
CD630_21300       CDS       T00487                                 

Gene name
dxr
Definition
(RefSeq) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
cdf  Clostridioides difficile 630
Pathway
cdf00900  Terpenoid backbone biosynthesis
cdf01100  Metabolic pathways
cdf01110  Biosynthesis of secondary metabolites
cdf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cdf00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CD630_21300 (dxr)
Enzymes [BR:cdf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     CD630_21300 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Semialdhyde_dh NAD_binding_3 Sacchrp_dh_NADP
Motif
Other DBs
NCBI-GeneID: 4914268
NCBI-ProteinID: YP_001088644
UniProt: Q185R8
Position
complement(2466836..2467990)
Genome map
AA seq 384 aa AA seqDB search
MKKISILGSTGSIGKQTLDVVRDNRDKFEIVAISANSNIELLLEQIVEFKPKYVTVFEEN
KALKLKEMLPKNIEIEVLAGMEGLKIISSLDEVDVLLTAVVGMIGLVPTLCAIKKGIDIA
LANKETLVTAGELVMKEAEKYNVNILPVDSEHSAIFQCLNGENKKNIEKIILTASGGPFR
GKKKGELVNITKNEALKHPNWSMGRKISIDSSTLMNKGLEVIEARWLFGVEQENIDVVVH
PQSIIHSMVQYTDSSIIAQLGCPDMRLPIQYALTYPDRMESSFERMNFSKFSTLTFEEPD
LETFPCLKLAYECLKMGGTYSSVLNSANEVLVSEFLEDKIGFYDIPYYIEKTLEVHSSIS
EPTLEEILETDRWSRAYVANLIKK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatatcaattttaggttctacaggctctataggtaaacaaactttggatgtg
gttagagataatagagataagtttgagatagttgcaatatcagctaacagtaatattgaa
ttattgctagaacagatagtagagtttaaacctaaatatgtaacagtttttgaggaaaat
aaagcattgaaattaaaagaaatgttgcctaaaaatatagaaatagaagttttagcagga
atggaaggattaaaaataatatcatcacttgatgaagtggatgtccttttaactgctgta
gtaggtatgataggattagtcccaactctttgtgctataaagaagggaatagacatagca
ttagcgaataaagaaacgttggtaactgctggtgaacttgtaatgaaagaagcagaaaaa
tacaatgtaaatattcttcctgttgatagtgaacatagtgctatatttcaatgtctaaat
ggagaaaataaaaaaaatatagaaaagataatacttacagcatctggtggtccatttaga
ggaaagaaaaagggagaacttgtaaatataactaaaaatgaagctttgaagcatccaaat
tggagtatgggaagaaaaataagtattgattcttcaacgcttatgaataaaggacttgaa
gtgatagaagctagatggttatttggagtagaacaagaaaatatagatgtagtagttcac
ccacaaagcataattcattcaatggtgcagtatacagatagctcaataattgctcaatta
ggatgtccagatatgagactaccaatacagtatgctcttacatatccagatagaatggaa
agtagctttgaaagaatgaatttttcaaaatttagtactttaacttttgaagaaccagat
ttagaaacttttccatgtttaaaattggcatatgagtgtttaaaaatgggaggaacttat
tcttctgttttaaattcagcaaatgaagttttagtaagtgaatttttagaggataaaatt
ggtttctatgacataccatattacatagagaagactttagaagttcatagtagcataagt
gaaccaacattagaagaaatcttagaaacagatagatggagtagagcttatgttgcaaat
ctgataaaaaaatag

DBGET integrated database retrieval system