KEGG   Clostridioides difficile 630: CD630_25880Help
Entry
CD630_25880       CDS       T00487                                 

Gene name
gmk
Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cdf  Clostridioides difficile 630
Pathway
cdf00230  Purine metabolism
cdf01100  Metabolic pathways
Module
cdf_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cdf00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CD630_25880 (gmk)
Enzymes [BR:cdf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CD630_25880 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 ADK AAA_22 ABC_tran Rad17 AAA_17 ATP_bind_1 MMR_HSR1 Cytidylate_kin RsgA_GTPase AAA AAA_16 cobW
Motif
Other DBs
NCBI-GeneID: 4914710
NCBI-ProteinID: YP_001089105
UniProt: Q182S8
Position
complement(2994173..2994790)
Genome map
AA seq 205 aa AA seqDB search
MFVKKGLLLVVSGPSGAGKGTICKELLKENDTIKLSVSATTRKPRTGEVDGVNYFFISKE
KFEEMIEKGEFLEYAQIYDNFYGTPKAAIMECLEKGQDVLLEIEMQGAKQIKEVCPEGVF
IFVLPPSLEELKNRIVGRGTETEAEIEKRFSCAYEEIKMIKDYDYFIFNEDVKTSAKEIE
GIISSEKNKVSRYKNIIIEKFKEEL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtgaaaaaaggattattgctagttgtatcaggaccatcaggtgcaggaaaaggt
actatttgcaaagaactacttaaagaaaatgatacaataaaactttctgtatcagctact
acaagaaaacccagaactggagaagttgatggagtaaattatttcttcataagtaaggaa
aagtttgaagagatgatagaaaaaggtgagtttttggagtatgctcaaatttatgataat
ttttatggaactccaaaagcggcaataatggaatgtttagaaaaaggacaagatgtatta
ctggagattgaaatgcaaggagcaaaacaaataaaagaagtttgcccagagggagtattt
atatttgtactaccaccatcacttgaagaattaaaaaatagaattgttggaagaggtaca
gaaacagaagctgaaatagagaagagatttagctgtgcatatgaagaaattaaaatgatt
aaggattatgattattttatatttaatgaagatgtaaaaacatctgctaaagaaatagaa
ggtataatatcatctgaaaagaataaagttagcagatataaaaatattataatagagaaa
tttaaggaggaattataa

DBGET integrated database retrieval system