KEGG   Clostridium difficile 630: CD630_26790Help
Entry
CD630_26790       CDS       T00487                                 

Gene name
bdhA
Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
cdf  Clostridium difficile 630
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:cdf00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:cdf00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3094677..3095453
Genome map
AA seq 258 aa AA seqDB search
MVKDKVVFVTGAASGIGKQIAESFLKNGAKVMFSDINQEALNNTITELQKKGYDCMSVKC
DVTKEEEINHAIDKTVEKYGRLDILINNAGLQHVSMIEDFPTDKFEFMIKIMLTAPFIAT
KKAFPIMKKQGFGRIINMASINGVIGFAGKAAYNSAKHGLIGLTKVAALEAADSGITVNA
LCPGYVDTPLVRGQFNDLSKTRNIPLENVLEEVLYPLVPQKRLLDVQEIADYAMFLASDN
AKGITGQACLLDGGYTAQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggttaaagataaagttgtattcgtaacaggagctgcaagtggaataggtaaacaaata
gctgaatcgttcttaaaaaatggtgctaaagtaatgttctctgatataaatcaagaagct
ttaaataataccataacagagttacaaaaaaaaggttatgattgcatgagtgtaaagtgt
gatgtaactaaggaagaagaaattaaccacgctatagacaaaactgttgaaaagtatggc
agattagatatattaataaacaatgctggacttcaacatgtttctatgatagaagatttc
ccaactgataaatttgaatttatgataaaaataatgctgacagcaccttttatagctact
aaaaaagcatttcctataatgaaaaaacaaggctttggtcgtataataaatatggcctca
atcaatggtgtaataggatttgctggaaaggctgcttataactcagcaaaacatggactt
attggactaacaaaagttgctgctcttgaagctgccgattctggtataacagttaatgct
ttatgccctggatatgtagatactccacttgtcagaggccagttcaatgacctttcaaaa
actcgtaatataccattggaaaatgtcttagaggaagttttatacccacttgtaccacaa
aaacgcctattagatgttcaagaaattgccgactatgctatgttcttagcaagtgataat
gctaagggtattacaggacaagcttgcttactagatggaggatatactgcacaatag

DBGET integrated database retrieval system