KEGG   Clostridioides difficile 630: CD630_26790Help
Entry
CD630_26790       CDS       T00487                                 

Gene name
bdhA
Definition
(RefSeq) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
cdf  Clostridioides difficile 630
Pathway
cdf00072  Synthesis and degradation of ketone bodies
cdf00650  Butanoate metabolism
cdf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdf00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    CD630_26790 (bdhA)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    CD630_26790 (bdhA)
Enzymes [BR:cdf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     CD630_26790 (bdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Polysacc_synt_2 Epimerase 3HCDH_N 3Beta_HSD Methyltransf_31 GDP_Man_Dehyd Ldh_1_N Methyltransf_25
Motif
Other DBs
NCBI-GeneID: 4914402
NCBI-ProteinID: YP_001089190
UniProt: Q183B5
Position
3094677..3095453
Genome map
AA seq 258 aa AA seqDB search
MVKDKVVFVTGAASGIGKQIAESFLKNGAKVMFSDINQEALNNTITELQKKGYDCMSVKC
DVTKEEEINHAIDKTVEKYGRLDILINNAGLQHVSMIEDFPTDKFEFMIKIMLTAPFIAT
KKAFPIMKKQGFGRIINMASINGVIGFAGKAAYNSAKHGLIGLTKVAALEAADSGITVNA
LCPGYVDTPLVRGQFNDLSKTRNIPLENVLEEVLYPLVPQKRLLDVQEIADYAMFLASDN
AKGITGQACLLDGGYTAQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggttaaagataaagttgtattcgtaacaggagctgcaagtggaataggtaaacaaata
gctgaatcgttcttaaaaaatggtgctaaagtaatgttctctgatataaatcaagaagct
ttaaataataccataacagagttacaaaaaaaaggttatgattgcatgagtgtaaagtgt
gatgtaactaaggaagaagaaattaaccacgctatagacaaaactgttgaaaagtatggc
agattagatatattaataaacaatgctggacttcaacatgtttctatgatagaagatttc
ccaactgataaatttgaatttatgataaaaataatgctgacagcaccttttatagctact
aaaaaagcatttcctataatgaaaaaacaaggctttggtcgtataataaatatggcctca
atcaatggtgtaataggatttgctggaaaggctgcttataactcagcaaaacatggactt
attggactaacaaaagttgctgctcttgaagctgccgattctggtataacagttaatgct
ttatgccctggatatgtagatactccacttgtcagaggccagttcaatgacctttcaaaa
actcgtaatataccattggaaaatgtcttagaggaagttttatacccacttgtaccacaa
aaacgcctattagatgttcaagaaattgccgactatgctatgttcttagcaagtgataat
gctaagggtattacaggacaagcttgcttactagatggaggatatactgcacaatag

DBGET integrated database retrieval system