KEGG   Peptoclostridium difficile 630: CD630_27150Help
Entry
CD630_27150       CDS       T00487                                 

Gene name
gtaB
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cdf  Peptoclostridium difficile 630
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cdf00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CD630_27150 (gtaB)
   00052 Galactose metabolism
    CD630_27150 (gtaB)
   00500 Starch and sucrose metabolism
    CD630_27150 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    CD630_27150 (gtaB)
Enzymes [BR:cdf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CD630_27150 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3141599..3142474)
Genome map
AA seq 291 aa AA seqDB search
MQMTVKKAIIPAAGLGTRFLPATKSQPKEMLPIVDKPTLQYIIEEAIESGIEEILIITGR
NKKSIEDHFDKSVELELELEQKGKTEMLEMVRDISNMVNIHYIRQKEPKGLGHAIYCAKS
FIGDEPFAVLLGDDIVDSDVPCLKQLIDTYNEYKTTVLGVQKIAKEDTNKYGILDVKHIE
DRVYKVKDMVEKPAIEEAPSDIAILGRYIITPAIFSILEKQTPGKGGEIQLTDALQTLGK
QEAIYAYNFEGRRYDVGDKIGFLEATIDFALKRENLKDDLMDYMRKKVSEK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgcagatgacagttaaaaaagcaataataccagcagcagggctaggaactagattttta
ccagcaacaaaatcacagcccaaagaaatgcttcctatagtagataaaccaactttacag
tatataatagaagaagctatagaatcgggaattgaagaaattcttataataacaggtaga
aataaaaaatctatagaagatcattttgataaatcagttgaattagagttagaactagag
caaaaaggtaagacagagatgttagaaatggtaagagacatatcaaatatggtaaatatt
cattatataagacaaaaagagccaaaaggtcttggacatgcaatttactgtgcaaaaagt
tttataggtgatgaaccttttgccgtattattaggtgatgatatagtagattcagatgtt
ccgtgcttaaaacaattaatagatacttataatgagtataaaacaactgtattaggtgtt
caaaagatagctaaagaagatactaataaatatggtatattggatgtaaaacatatcgaa
gatagagtatataaagttaaagatatggttgaaaaacctgcaattgaagaagctccatct
gatatagctatacttggaagatatataataactcctgcaatatttagcatattagagaaa
cagacacctggtaaaggtggagagatacaactgacagatgcacttcaaactcttggaaaa
caagaggctatttatgcttataactttgaaggtagaagatatgatgtgggagataagatt
ggttttttagaggcaacaatagactttgctctaaagagagaaaatttaaaagatgattta
atggactatatgagaaaaaaagtaagtgaaaaataa

DBGET integrated database retrieval system