KEGG   Clostridium difficile 630: CD630_29660Help
Entry
CD630_29660       CDS       T00487                                 

Gene name
adhE
Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase (EC:1.2.1.10 1.1.1.1)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
cdf  Clostridium difficile 630
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cdf00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CD630_29660 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD630_29660 (adhE)
   00620 Pyruvate metabolism
    CD630_29660 (adhE)
   00650 Butanoate metabolism
    CD630_29660 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    CD630_29660 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    CD630_29660 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CD630_29660 (adhE)
   00626 Naphthalene degradation
    CD630_29660 (adhE)
Enzymes [BR:cdf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CD630_29660 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     CD630_29660 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3445219..3447822)
Genome map
AA seq 867 aa AA seqDB search
MSVGLDTVNNVESLVKKLAKIREAQKIFATYSQEQVDKIFLAASLAANKQRVPLAIMAQK
ETGMGIAEDKVIKNHYASEYIYNAYKETKTCGVIEKDEAFGMTKIAEPIGVIAAVVPTTN
PTSTAIFKALLALKTRNGIIFSPHPRAKNSTIEAAKVVLEAAVLAGAPEGIIGWIDEPSL
ELTTTVMKEVDLTLATGGPGMVKSAYSSGKPAIGVGAGNTPAIIDDSADIKTAVNSILVS
KTFDNGMICASEQSVIVLENIYNEVKKEFKERGAYLLDKDETEKIRNIILVNGGLNSKIV
GQTACTIAKLAGFEVPVDTKVLIGEVESVEIEEAFAHEKLSPVLAMYKASDFDDAVRKAE
KLVEDGGFGHTSSLYIDDVNQREKLDKFTSAMKTCRILINTPSSQGGIGDLYNFKLAPSL
TLGCGSWGGNSVSENVGVKHLLNIKTVAERRENMLWFRAPEKVYFKKGCLGVALKELKDV
MNKKRAFIVTDTFLYNNGYTKAVTDLLDEMNIKHTTFFEVEPDPTLECAKIGAKAMREFN
PDVIISIGGGSAMDAGKIMWTLYEHPDVDFQDLAMRFMDIRKRVYTFPKMGEKANFVAIP
TSAGTGSEVTPFAVITDQDTGVKYPLADYELMPNMAIVDSDMMMNMPKSLTSASGIDALT
HALEAYVSMLATDYTNGLALQAIKSIFEYLPRAYDNGAKDPEAREKMANASTMAGMAFAN
AFLGVCHSMAHKLGAFHHVPHGVANALLITEVMKFNSSDAPKKMGAFSQYKYPEALKRYA
GIASFLGLKGNSDEEKFQSLLVAIEDLKLKVGIPKSIKEFGVEESKFMDSIDEMVIQAFD
DQCTGANPRYPLMNEIKDMYLNSYYGR
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttggtttagatactgtaaataacgttgaaagcttagttaaaaaactagcaaaa
atcagagaagctcaaaaaatatttgctacatatagtcaagagcaggtagataaaattttt
ttagcagcatctttggcagctaataagcaaagagttcctctagctataatggcacaaaaa
gaaactggtatgggaattgctgaagataaggttataaagaatcattatgcctcagagtat
atatataatgcatataaagaaactaaaacttgtggtgttatagagaaagacgaagcattt
ggtatgactaaaattgctgaaccaataggtgttattgcagcagttgtacctacaactaat
ccaacttctactgctatctttaaagcacttttagctttaaaaactagaaatggaataatt
ttctctccacatccaagagcaaaaaattctactatagaggctgcaaaagttgttcttgag
gctgctgttttagctggagctcctgaaggtataataggatggatagatgagccatcttta
gaattaactacaactgttatgaaagaagtggatttgacccttgctacaggaggtcctgga
atggttaaatcagcatattcatctggaaaaccagctattggagttggtgcaggtaatact
ccagcaataattgatgatagtgcagatataaaaactgctgtaaactcaattcttgtatct
aagacttttgacaatggtatgatatgtgcttctgaacaatcggttatagtattagaaaat
atatacaatgaagtcaaaaaagaatttaaagagcgtggtgcttatttattagataaagat
gaaacagaaaaaataagaaatataattttagtaaatggaggattaaattctaaaatagtt
gggcaaacagcttgtactatagcaaaacttgcaggctttgaagtcccagtagatactaag
gttttaataggtgaagtagaatcagttgaaatagaagaagcttttgctcatgagaaactt
tcaccagtacttgcaatgtacaaggcaagtgattttgatgatgcagttagaaaagcagaa
aaattagtagaagatggtggatttgggcatacatcttcattatatattgatgatgtaaat
caaagagaaaaacttgataagtttacttcagccatgaaaacttgtagaattttaattaat
actccttcttctcaaggtggtataggggacttatataattttaaactagctccttctctt
actttaggatgtgggtcttggggtggaaattcagtatctgaaaatgtaggagttaagcat
ttacttaatattaaaacagtagctgagaggagagaaaatatgctttggtttagagcacca
gaaaaagtttatttcaaaaaaggttgtttaggagtagcattaaaagaacttaaagatgta
atgaataagaagagagcttttattgtaacagatacattcctttacaataatggatatact
aaagcagttactgatttattagatgaaatgaatattaagcacactacattctttgaagta
gaaccagacccaactttggaatgtgctaagataggcgctaaagctatgagagaatttaat
ccagatgtaataatatctataggtggaggaagtgcaatggatgcaggaaagataatgtgg
acattgtatgagcatccagatgtagatttccaagacctagctatgagatttatggatata
agaaaaagggtatatacattccctaaaatgggtgaaaaagctaattttgtagctatacca
acatcagcaggtactggttcagaagtaacaccatttgctgttataactgaccaagataca
ggagtaaaatatccattagcagattatgaactgatgccaaatatggctatagttgattct
gatatgatgatgaatatgccaaaaagcttaacatctgcttctggtatagatgctttaact
catgcattagaagcatatgtatctatgcttgcaaccgattatacaaatggattagcttta
caagctattaagagtatatttgaatatcttccacgtgcatatgataatggtgcaaaagac
ccagaagctagagaaaaaatggcaaatgcttctacaatggcaggtatggcttttgcaaat
gcatttttgggtgtttgtcactctatggctcataaattaggtgctttccaccatgtacca
catggtgttgcaaatgctcttttgataacagaagttatgaaatttaattcttcagatgca
ccaaagaaaatgggagcattctctcaatataaatatccagaagcattaaagagatatgct
ggaatagcttcatttttaggattaaaaggaaattctgatgaagagaaattccaaagttta
ttggtagctattgaagatttaaaacttaaagttggtattcctaaatctataaaagagttt
ggcgttgaagaatctaagtttatggattcaatagatgaaatggtaattcaagcatttgat
gaccaatgtacaggagcaaatccaagatatccacttatgaatgaaataaaagatatgtat
ttaaattcatattatggaagataa

DBGET integrated database retrieval system