KEGG   Clostridioides difficile 630: CD630_31100Help
Entry
CD630_31100       CDS       T00487                                 

Definition
(RefSeq) 6-phosphofructokinase
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
cdf  Clostridioides difficile 630
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cdf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD630_31100
   00030 Pentose phosphate pathway
    CD630_31100
   00051 Fructose and mannose metabolism
    CD630_31100
   00052 Galactose metabolism
    CD630_31100
  Energy metabolism
   00680 Methane metabolism
    CD630_31100
Enzymes [BR:cdf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CD630_31100
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     CD630_31100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
3618638..3619852
Genome map
AA seq 404 aa AA seqDB search
MRNCIIAQSGGPTAVINASAVGIYEKNLETKYFDKVYFGINGIEGILNKNIIDSDSLNKD
NVLNLKQTPSSGLGSCRYKLADYKINSYDYDRVINILDEYEIDTLFYIGGNDSMDTVMKF
SQYCKNTTCKIKFIGIPKTIDNDLLGTDNCPGFGSAAKLISTLIMETYLDFSIYKNNGIF
IVETMGRDTGWLAASSSLARLNDTPLVDLIYLPEIDFYEDKFIEDVRKIFKEKNKAYIVA
SEGIRDKYGNFICEQKTSAHDKFGHSQLGGVSNYLKNLIVSSSITTRVKTLELGVIQRCA
MHLASDTDLKQAAEVGAYGIELSKKGYTGVMAIINRTCNNPYKYEVSHTDISKIANKTKY
FPKEWINEECNYITDEALNYLYPLIQGKPDIKYKNGLPYFSIIY
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagaaactgtattattgcccaatctggaggccctacagctgttatcaatgcttctgca
gttggtatttatgaaaaaaatttagaaactaaatactttgataaagtatattttggtatc
aatgggattgaaggtatattaaacaaaaatataatagattcagactccttaaacaaagat
aatgtattaaatttaaagcaaacaccttcgtctggtcttggttcttgtagatacaaactg
gctgattataaaataaattcttatgattatgatagagttataaatatactagatgaatat
gaaatagatacattattttatataggcggaaatgattctatggacacagtgatgaaattt
tctcaatactgcaaaaacactacttgtaaaataaaatttataggtattcctaaaacaata
gataatgatttattaggaactgacaactgtcctggatttggttctgctgcaaagcttatt
tctacactaataatggaaacatacttagatttttctatatacaaaaataatggtatattt
atagtagaaactatgggtagagatactggatggttagcagcttcttcttcactagctaga
cttaatgatactccacttgttgatttaatataccttccagaaattgatttctatgaagat
aagtttatagaagatgttagaaaaatatttaaagaaaaaaataaggcttatatagttgca
tcagaaggtataagggataaatacggcaactttatatgcgaacaaaaaacttctgctcat
gataaatttggtcattcccaattaggtggagtaagcaactatctaaagaatcttatagta
tcatcatcaattacaacaagagtaaaaaccttagaacttggtgtaatacaaagatgtgct
atgcatttagcttcagatactgatttaaaacaagcagctgaagttggtgcatatgggata
gaactatctaaaaaaggatatacaggagttatggctatcattaatagaacatgcaataat
ccttataagtatgaagttagtcatactgatatttctaaaatagctaacaagacaaaatat
tttcctaaagagtggataaatgaagaatgtaattatataactgatgaagccctaaattat
ctatatccacttattcaaggtaaaccagatatcaaatataaaaatggactaccttatttt
tcaattatttactag

DBGET integrated database retrieval system