KEGG   Peptoclostridium difficile 630: CD630_31150Help
Entry
CD630_31150       CDS       T00487                                 

Gene name
bglA
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
cdf  Peptoclostridium difficile 630
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:cdf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD630_31150 (bglA)
Enzymes [BR:cdf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     CD630_31150 (bglA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3626875..3628329)
Genome map
AA seq 484 aa AA seqDB search
MNIKDTFFWGGSIAAHQCEGSWDSDNKGPAIMDFVTKGSYETPRVITDKIEEKLDYPSHN
GIDFYNRYKEDIALFKEMGFSALRISIDWSRIFPNGDDENPNELGIKYYEGLIDTLIENN
IEPIVTLYHFELPMNLVHKYGSWNNRKLIDLYLKYSETVIRRFDDKVKYWVTFNEMNHID
PQTEHSDIFTYMIAGIKYSEIENKVQTLANVGYNMTLAGVKVAKLAREINPNNKVGCVFG
LNPIYPYNCNPSNVLNAFLDNDRDYYQIDAMCNGKFPQYKLKEYEKNNITIEVTDEDKKA
FKEGKLDFIGLNYYFSSVSTPKENLSGDKSLFGGIQNPYLEQSKWGWAIDPIGLRFTLNY
IYRKYQLPILITENGLGAYDKIEEDGTINDDYRIEYLSKHLSQMKSAIEEDNVECFGYLM
WGPIDLVSATTGQMSKRYGFIYVDLDDEGKGSFKRYKKKSFDWYKEVIKSNGEVLDFSTD
IVVG
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaatattaaagatacatttttctggggaggaagtattgcagcccatcaatgtgaaggt
tcatgggatagtgataacaaaggacctgcaattatggattttgtaactaagggctcttat
gaaacgccaagagtaattactgataaaatagaagaaaaattggattatccatctcataat
ggaatagatttttataatagatataaagaagatatagctttatttaaagaaatgggattt
agtgcattaagaatatctatagattggtcaagaatttttccaaatggagatgatgaaaat
cctaatgaattagggattaaatactatgaaggtctgatagatacattaatagaaaataat
atagaacctattgtaacactatatcattttgaattacctatgaatttagtacataaatat
ggttcatggaataacagaaaacttatagatttgtatttaaagtacagtgagactgtaata
agaagatttgatgataaggtaaagtactgggttacatttaatgagatgaaccatattgac
cctcaaacagagcactcggatatttttacttatatgatagcaggtattaagtatagtgaa
atagaaaataaggttcaaacattggcaaatgtagggtataatatgactttggcgggtgta
aaggttgcaaagttggctagagaaatcaatcccaacaataaagttggatgtgtatttgga
ctaaatccaatttatccatacaattgtaatcctagtaatgtgttaaatgcatttttagat
aatgaccgtgattattatcaaattgatgcaatgtgcaatgggaagtttccacaatataaa
ttaaaagaatatgaaaaaaataatataactattgaagtgactgatgaagacaaaaaagca
tttaaagaaggtaagttagattttataggacttaattattatttttcaagtgtatctact
ccaaaagaaaatttatcaggtgataaatctttatttggtgggattcaaaatccatatttg
gaacaaagtaagtgggggtgggcaatagaccctataggtttaagatttaccttgaactat
atttacagaaagtatcaattacctatcttaattacagaaaatggtttaggggcatatgat
aaaatcgaagaagatggaactataaatgatgattatagaattgaatatttaagtaagcat
ctatctcaaatgaagtctgcaattgaagaagataatgttgaatgttttggatatttgatg
tggggaccaattgatttagtcagtgcaactacaggtcagatgagtaagagatatggattt
atctatgttgacttagatgatgaaggcaaaggaagttttaagagatataagaaaaaatca
tttgattggtacaaagaagtaataaaatctaatggagaagttttagatttttctacggat
atagtagtagggtaa

DBGET integrated database retrieval system