KEGG   Clostridioides difficile 630: CD630_31720Help
Entry
CD630_31720       CDS       T00487                                 

Gene name
tpi
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cdf  Clostridioides difficile 630
Pathway
cdf00010  Glycolysis / Gluconeogenesis
cdf00051  Fructose and mannose metabolism
cdf00562  Inositol phosphate metabolism
cdf01100  Metabolic pathways
cdf01110  Biosynthesis of secondary metabolites
cdf01120  Microbial metabolism in diverse environments
cdf01130  Biosynthesis of antibiotics
cdf01200  Carbon metabolism
cdf01230  Biosynthesis of amino acids
Module
cdf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cdf_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cdf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD630_31720 (tpi)
   00051 Fructose and mannose metabolism
    CD630_31720 (tpi)
   00562 Inositol phosphate metabolism
    CD630_31720 (tpi)
Enzymes [BR:cdf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CD630_31720 (tpi)
Exosome [BR:cdf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CD630_31720 (tpi)
  Exosomal proteins of bladder cancer cells
   CD630_31720 (tpi)
  Exosomal proteins of melanoma cells
   CD630_31720 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Creatinase_N
Motif
Other DBs
NCBI-GeneID: 4913220
NCBI-ProteinID: YP_001089689
UniProt: Q181T6
Position
complement(3706953..3707696)
Genome map
AA seq 247 aa AA seqDB search
MRKPIIAGNWKMHKTIKEALEFVNEIKDKVNSDKVEAVICAPFTLLKDLKEATKGTNIKI
GAQNMHFEEKGAFTGEVSPLMLKEIDMDYVVIGHSERRQYFNETDETVNKKVLKALEVGI
DPILCVGETLEQREAGKTKDVCKVQVEKALENVLKDDLAKVVVAYEPIWAIGTGKTATAE
DANDVISYIREVIKGLYGELANEVRIQYGGSVKPSNVAEIMGQSDIDGALVGGASLASND
YLDLVNF
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaacctataattgcaggaaactggaaaatgcataaaacaataaaagaagcttta
gaatttgtaaatgaaattaaagataaagtaaattctgataaagtagaagctgttatatgt
gcaccatttactttattaaaggatttaaaagaagctactaagggtacaaatataaagata
ggtgctcaaaatatgcactttgaagaaaaaggagcatttacaggagaagtttcacctctt
atgttaaaagaaatagatatggactatgttgtaataggacattcagaaagaagacaatac
ttcaatgaaactgatgaaactgtaaacaagaaagttttaaaagcattagaagtaggaata
gacccaatattatgtgttggagaaactttagaacaaagagaagctggaaaaactaaagat
gtttgtaaagttcaagttgaaaaagctttagaaaatgttcttaaagatgatttagcaaaa
gtagttgttgcatatgagccaatctgggctattggaactggtaaaactgcaactgctgaa
gatgctaatgacgttatatcttatataagagaagttataaaaggattatatggagaatta
gctaatgaagttagaatacaatacggtggaagtgttaaaccttcaaatgtagccgaaata
atgggtcaaagtgatatagatggagctttagtaggtggagctagtttagctagtaatgat
tacctagaccttgttaatttctaa

DBGET integrated database retrieval system