KEGG   Peptoclostridium difficile 630: CD630_31720Help
Entry
CD630_31720       CDS       T00487                                 

Gene name
tpi
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cdf  Peptoclostridium difficile 630
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cdf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CD630_31720 (tpi)
   01230 Biosynthesis of amino acids
    CD630_31720 (tpi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD630_31720 (tpi)
   00051 Fructose and mannose metabolism
    CD630_31720 (tpi)
   00562 Inositol phosphate metabolism
    CD630_31720 (tpi)
Enzymes [BR:cdf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CD630_31720 (tpi)
Exosome [BR:cdf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CD630_31720 (tpi)
  Exosomal proteins of bladder cancer cells
   CD630_31720 (tpi)
  Exosomal proteins of melanoma cells
   CD630_31720 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3706953..3707696)
Genome map
AA seq 247 aa AA seqDB search
MRKPIIAGNWKMHKTIKEALEFVNEIKDKVNSDKVEAVICAPFTLLKDLKEATKGTNIKI
GAQNMHFEEKGAFTGEVSPLMLKEIDMDYVVIGHSERRQYFNETDETVNKKVLKALEVGI
DPILCVGETLEQREAGKTKDVCKVQVEKALENVLKDDLAKVVVAYEPIWAIGTGKTATAE
DANDVISYIREVIKGLYGELANEVRIQYGGSVKPSNVAEIMGQSDIDGALVGGASLASND
YLDLVNF
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaacctataattgcaggaaactggaaaatgcataaaacaataaaagaagcttta
gaatttgtaaatgaaattaaagataaagtaaattctgataaagtagaagctgttatatgt
gcaccatttactttattaaaggatttaaaagaagctactaagggtacaaatataaagata
ggtgctcaaaatatgcactttgaagaaaaaggagcatttacaggagaagtttcacctctt
atgttaaaagaaatagatatggactatgttgtaataggacattcagaaagaagacaatac
ttcaatgaaactgatgaaactgtaaacaagaaagttttaaaagcattagaagtaggaata
gacccaatattatgtgttggagaaactttagaacaaagagaagctggaaaaactaaagat
gtttgtaaagttcaagttgaaaaagctttagaaaatgttcttaaagatgatttagcaaaa
gtagttgttgcatatgagccaatctgggctattggaactggtaaaactgcaactgctgaa
gatgctaatgacgttatatcttatataagagaagttataaaaggattatatggagaatta
gctaatgaagttagaatacaatacggtggaagtgttaaaccttcaaatgtagccgaaata
atgggtcaaagtgatatagatggagctttagtaggtggagctagtttagctagtaatgat
tacctagaccttgttaatttctaa

DBGET integrated database retrieval system