KEGG   Clostridioides difficile 630: CD630_33950Help
Entry
CD630_33950       CDS       T00487                                 

Gene name
pfkA
Definition
(RefSeq) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cdf  Clostridioides difficile 630
Pathway
cdf00010  Glycolysis / Gluconeogenesis
cdf00030  Pentose phosphate pathway
cdf00051  Fructose and mannose metabolism
cdf00052  Galactose metabolism
cdf00680  Methane metabolism
cdf01100  Metabolic pathways
cdf01110  Biosynthesis of secondary metabolites
cdf01120  Microbial metabolism in diverse environments
cdf01130  Biosynthesis of antibiotics
cdf01200  Carbon metabolism
cdf01230  Biosynthesis of amino acids
cdf03018  RNA degradation
Module
cdf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cdf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD630_33950 (pfkA)
   00030 Pentose phosphate pathway
    CD630_33950 (pfkA)
   00051 Fructose and mannose metabolism
    CD630_33950 (pfkA)
   00052 Galactose metabolism
    CD630_33950 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    CD630_33950 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CD630_33950 (pfkA)
Enzymes [BR:cdf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CD630_33950 (pfkA)
Protein phosphatases and associated proteins [BR:cdf01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CD630_33950 (pfkA)
Messenger RNA biogenesis [BR:cdf03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CD630_33950 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-GeneID: 4913056
NCBI-ProteinID: YP_001089915
UniProt: Q180P4
Position
complement(3970838..3971797)
Genome map
AA seq 319 aa AA seqDB search
MKTIGLLTSGGDAPGMNAAIRAVVRSAIYYGCKVYGINRGYKGLLEEDLTEMNLSSVGDI
IHRGGTILKSSRCEEFKTEEGRLKAVKILKKYKIDCLVVIGGDGSFAGAQKLSDLGFPAI
GIPGTIDNDLAYTDYTIGFDTAMNTIIDAIGKIRDTSSSHERVNIVEVMGRHCGDLALYA
GLAGGAETIIVPEVEITVDEVALRLKTTQKRGKRHSIIVLAEGVGSASDLEKELKKESGA
DLRVTVLGHVQRGGSPTVSDRILASRLGVRAVELLLDGKSARVVGIKENKIIDLEISEAL
AQKKVFDKEAYEMAKILSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactataggattactaacaagtggaggagatgctccaggaatgaatgctgcgatt
agagcggttgtaagatcagcaatatattatggatgcaaagtatatggaatcaatagagga
tataagggattactagaagaagatttaactgaaatgaacttatcttctgttggagatatt
atacacaggggaggaactatattaaaatcttccagatgtgaagaatttaaaacagaagaa
ggtagattaaaagcagtaaaaattcttaaaaagtataaaattgattgcttagttgtaatt
ggtggagatggttcatttgcaggagctcaaaaacttagtgacttaggattcccagctata
ggcataccaggaactatagataacgatttagcatatacagattatactataggatttgat
actgcaatgaatactattatagatgctataggtaagataagagatacatcatcatctcat
gaaagagttaacatagtagaagttatgggaagacactgtggagatttagccttatatgca
ggtcttgcaggaggagcggaaactataatagtaccagaagtagaaattacagtagatgaa
gttgctctaagattaaagactactcaaaaaagaggtaagagacatagtataatcgtttta
gcagaaggagtcggaagtgctagtgatttagaaaaggaacttaaaaaagagtcaggagca
gatttaagagtcactgtattggggcatgtccaaagaggaggaagcccaactgtatctgat
agaatactagcaagtagacttggagtaagagcagtagaattattattagatggaaaatca
gctagagttgtaggaataaaagaaaacaaaataattgatttagaaataagtgaagcttta
gctcaaaagaaagtatttgataaagaagcttatgagatggcaaaaatattatctatataa

DBGET integrated database retrieval system