KEGG   Peptoclostridium difficile 630: CD630_34880Help
Entry
CD630_34880       CDS       T00487                                 

Gene name
gtaB
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cdf  Peptoclostridium difficile 630
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cdf00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CD630_34880 (gtaB)
   00052 Galactose metabolism
    CD630_34880 (gtaB)
   00500 Starch and sucrose metabolism
    CD630_34880 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    CD630_34880 (gtaB)
Enzymes [BR:cdf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CD630_34880 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4076466..4077431)
Genome map
AA seq 321 aa AA seqDB search
MQVKVKKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPTLQYIIEEAVASGIEEILIITGR
NKKSIEDHFDKSVELELDLEKKGKKELLEVVQNISNMINIHYIRQKEPKGLGDAIYCARH
FIGDEPFAVMLGDDIVDNDVPCLKQLTDAYEEYRTTILGVQKVNQEDTNKYGIIEAKNIE
GRVYKVKDMVEKPESGKAPSNIAILGRYIITPEIFDILKDLPPGKGGEVQLTDALKILSK
KEAMYAYNFEGKRYDVGDKLGFLEATVDFALKKEDLKEDFIKYLKHVCSEFDKNNNVLYN
NTDEKIDLIEVNEARELEIQK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgcaagttaaagttaaaaaggctgtaataccagcagcaggtttaggaactagatttttg
ccagctacaaaggcacaaccaaaagagatgttaccaatagttgataagccaactctacaa
tacataatagaagaagctgtggcctcaggaatagaggaaatactaataataacaggtaga
aataaaaaatctattgaagaccactttgataaatctgtagaattggaacttgatttagag
aaaaaaggtaagaaagaattgttggaggtagtacaaaacatatctaacatgattaacata
cattatataagacaaaaagagccaaaagggttgggagatgcaatttattgtgcgaggcat
tttataggtgatgagccgtttgcagtaatgttaggggatgatattgtagataatgatgta
ccttgtctaaaacaactaacagatgcatatgaggaatatagaactacaatattgggtgtt
caaaaggtaaatcaagaagatactaataaatatgggataatagaagcaaaaaatatagaa
ggtagagtttacaaggtaaaagacatggtagaaaagccagagtcaggaaaagctccttca
aatattgctattttaggtagatatataataactcctgaaatctttgatattcttaaggat
ttaccaccaggtaaaggtggagaggtacaacttacagatgctttaaaaatattatctaag
aaagaagctatgtatgcatacaattttgaaggcaagagatatgatgttggggacaagcta
ggatttttagaagctactgttgactttgctctaaagaaagaagaccttaaggaagatttt
ataaaatatttgaaacatgtatgtagtgaatttgataaaaataacaatgtgttatacaat
aatacagatgaaaaaatagatttaattgaagtcaatgaagctagagaacttgaaattcaa
aaataa

DBGET integrated database retrieval system