KEGG   Clostridioides difficile 630: CD630_35660Help
Entry
CD630_35660       CDS       T00487                                 

Gene name
ispE
Definition
(RefSeq) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cdf  Clostridioides difficile 630
Pathway
cdf00900  Terpenoid backbone biosynthesis
cdf01100  Metabolic pathways
cdf01110  Biosynthesis of secondary metabolites
cdf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cdf00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CD630_35660 (ispE)
Enzymes [BR:cdf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     CD630_35660 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C TFX_C
Motif
Other DBs
NCBI-GeneID: 4914205
NCBI-ProteinID: YP_001090089
UniProt: Q181G8
Position
complement(4166774..4167664)
Genome map
AA seq 296 aa AA seqDB search
MDFIRLKSRAKINLSIDVLGKRQDGYHFVEMIMQTIDLYDIVKIKELDEDEIKVKSTSLD
IPLDEDNIVYKAAKILKNKFYIKKGVEIFIEKNIPVAAGMAGGSSNAAAVLVGLNHLWEL
RLSEDELKEIGLNLGADVPFCISGRPALAQGIGEKLTNIKGLPCDTNILICKPDLFVSTK
EVYQGLDLNNIKKRPNNKYLIECLKSEDIKAVSESMVNILENVTIGKHKEISDIKQVMMK
NNALGSMMSGSGPTVFGLFKNKEDALIGKKELLKKYKQVYVVNSSQKGVEICGEFN
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggattttataagactaaagagtagagcaaaaataaatttatccattgatgtcttggga
aaaaggcaagacggttatcattttgttgaaatgataatgcaaacgatagatttatacgat
atagtaaagataaaagaattagacgaagatgaaataaaggtaaaaagcactagtttagat
attcctttagatgaagataatattgtttataaagctgccaaaatacttaaaaataaattt
tatataaaaaaaggtgtagaaatattcatagaaaaaaatattcctgtagcagcagggatg
gctggaggaagttctaatgcagccgcagtattagtaggtttaaatcacctatgggaactt
agattatctgaagatgaattaaaagaaataggacttaatttgggcgcagatgttcctttt
tgtatatcaggaagacctgccttagctcaaggtattggagaaaagctaacaaacatcaaa
ggtttaccatgtgatacaaatatattgatatgcaaaccagacttattcgtttctactaaa
gaagtttatcaaggattagatttgaataatattaaaaaaagaccaaataataaatatttg
atagagtgtttaaaatctgaagatataaaagctgtatcagaaagcatggtaaatattctt
gaaaatgttactataggtaaacacaaagaaataagtgatataaaacaagtaatgatgaaa
aataatgctttaggttctatgatgagtggaagtggtcctacagtttttggactatttaaa
aataaagaagatgctctaattggaaaaaaagaattattaaaaaaatataaacaggtgtat
gttgttaatagcagtcaaaaaggggttgaaatttgtggagaatttaactaa

DBGET integrated database retrieval system