KEGG   Clostridioides difficile 630: CD630_36750Help
Entry
CD630_36750       CDS       T00487                                 

Gene name
mnmG
Definition
(RefSeq) tRNA uridine 5-carboxymethylaminomethyl modification protein GidA
  KO
K03495  
tRNA uridine 5-carboxymethylaminomethyl modification enzyme
Organism
cdf  Clostridioides difficile 630
Brite
Transfer RNA biogenesis [BR:cdf03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    CD630_36750 (mnmG)
 Prokaryotic Type
    CD630_36750 (mnmG)
Chromosome [BR:cdf03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    CD630_36750 (mnmG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(4283934..4285829)
Genome map
AA seq 631 aa AA seqDB search
MIKFEAGKYDVIVVGAGHAGCEAALATARMGYKTLIITMSLDSIALMPCNPSIGGTGKGQ
LVKEIDALGGQMGLNIDKTYIQSRMLNTAKGPAVHSLRAQADKFKYHEEMKKTLEDEPNL
DIAMDEVVEILHEGNVVIGVGTKLGCSFKSKAVILATGVYLNSKIYMGEVAFYEGPNALG
YAKYLTDSLVELGLRMRRFKTGTPARVHRDSIDFSVMSLQEGDEKVTPFSFMNENIEKKQ
EPCYLTRTTEETQKVILDNLKRSAMYSGVIESTGPRYCPSIEDKVVRFSDKTSHQLFIEP
EGLNTKEMYIQGISTSLPFEVQLDMYKTIKGLENCKIMRPAYAIEYDCVDPTQLKISLEI
KGVENLFSAGQFNGTSGYEEAAAQGLMAGINAVRKIEGKEPFVLDRSEAYIGVLLDDLVT
KGTNEPYRMMTSRAEYRLYLRQDNADMRLTQKGYDIGLVKKDRYERFLNKKAAVEKEFER
LKNERVTPKEVNSLLEEKGATPIKVGISLYEFLKRPEVTYELLEELGKGAGDDVSREVKE
QCVIITKYEGYIEKQLKQIDQFKKLENKKLDEKINYSSIEGLRLEARQKLDDIKPISIGQ
ASRISGVSPADISVLLIYLEQIRRTRGGKGE
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgataaagtttgaagcaggaaaatatgatgttatagtagtcggagcaggacatgctgga
tgtgaagctgctttggctactgcaagaatgggatataaaactttgataataacaatgtct
ttggattccatagcattaatgccttgtaatccatcaattggagggactggtaaaggtcaa
ttagttaaagaaatagatgccttaggcggtcagatgggattaaatatagacaagacatat
atacaaagtagaatgttaaatactgccaaaggtccagcggtacactctttaagagcacaa
gcagataaatttaaatatcatgaagaaatgaaaaagacattagaagatgaaccaaatctt
gatatagctatggatgaagttgtagaaatacttcatgaaggaaatgttgtaataggagtt
ggaactaaactaggatgttcatttaaatctaaagctgtaatattggccactggagtttat
ctgaactcaaagatatatatgggtgaagttgcattttatgaaggtcctaatgcattgggg
tatgcaaaatatcttacagatagcttagttgagcttggtcttagaatgagaagatttaag
acgggaactccagcaagagttcatagagatagtatagacttctctgtaatgtctttacaa
gagggtgatgaaaaagtaactccattctcatttatgaatgaaaatatagaaaaaaaacaa
gaaccttgttatttaacaagaactacagaagaaactcaaaaagttatactggataattta
aaaaggtctgctatgtatagtggagtaatagaaagtactggtccaagatactgtccttct
atagaagataaagtagtacgatttagtgataaaacatcacatcaattatttatagaacca
gaagggttaaatactaaagaaatgtatatacaaggaatttcaactagtttaccttttgaa
gttcaattagatatgtacaaaactataaagggacttgaaaattgtaagataatgagacct
gcatatgctattgaatatgattgtgttgacccaactcaactaaaaataagtttggaaata
aagggtgttgagaacttatttagtgcagggcaatttaatggaacttctggatacgaggaa
gcagcagctcaagggcttatggctggtataaatgcagttagaaagatagaaggaaaagag
ccatttgtattagaccgttcagaagcttatataggtgtcttattagatgaccttgttact
aaaggaactaacgagccttacagaatgatgacatcaagagcagaatatcgactatattta
agacaagataatgcagatatgagattaactcaaaaaggttatgatataggattagttaaa
aaagatagatatgaaaggtttctaaataaaaaggctgctgtagagaaagaatttgaaaga
ctaaaaaatgaaagagttacaccaaaagaagtaaatagtttgttagaagaaaaaggagca
acaccaataaaggttggaatatctctatatgaatttttaaagagaccagaggttacttac
gaattgcttgaagaattagggaaaggcgctggagatgatgtttcaagagaagttaaagaa
cagtgtgtaataataactaaatatgaaggttatatagagaaacaattgaaacaaatagac
caatttaaaaaacttgagaataaaaagctggatgagaaaataaattattcatctatagaa
ggtcttagattagaggctagacagaaactagatgatataaaacctatttcaatagggcaa
gcatctcgtatatctggtgtttctccagctgatatatcagttttacttatatacctagaa
caaatcagaagaactagaggtggcaaaggtgaataa

DBGET integrated database retrieval system