KEGG   Peptoclostridium difficile BI1: CDBI1_00095Help
Entry
CDBI1_00095       CDS       T01779                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cdg  Peptoclostridium difficile BI1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cdg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CDBI1_00095
DNA repair and recombination proteins [BR:cdg03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      CDBI1_00095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
27680..28279
Genome map
AA seq 199 aa AA seqDB search
MQVYTGPITRLIEEFSKLPGVGRKTAQRLAFHIINMNTNDVEALSKAIIDAKREIRYCSI
CCNITDTDPCSMCSNKSRDSSVICVVEDPRDVAAMERTREFKGQYHVLNGVISPMDGIGP
DMLKIKELIQRLGNQEVKEIIMATNPTIEGEATAMYIARLVKPMGIKVTRIAHGLPVGGD
LEYADEVTISKALEGRREI
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtttatacaggtcccataacgagacttatagaggaattttcaaagcttcctgga
gtaggaagaaagactgctcaaagattggcttttcatattattaatatgaatactaatgat
gtggaagctttatctaaagcgattatagatgcaaaaagagaaataagatattgctcaatt
tgttgtaatataacagatacagacccatgtagcatgtgttcaaataaaagtagagattca
agtgttatatgtgttgtggaagatccaagagatgtagcagctatggagagaacgagagag
tttaaaggacagtatcatgtattaaatggagtaatttctccaatggatggaattggacca
gatatgttaaaaataaaggaacttatccaaagacttggcaatcaggaagtcaaagaaata
ataatggcaacaaatcctactattgaaggtgaagcgacagccatgtatattgctaggtta
gtaaaaccaatgggaatcaaagtcactcggatagctcatggtcttcctgttggaggcgat
ttagagtatgcagatgaggtcacaatatcaaaagcactagaaggcagaagagaaatataa

DBGET integrated database retrieval system