KEGG   Clostridium difficile BI1: CDBI1_00270Help
Entry
CDBI1_00270       CDS       T01779                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
cdg  Clostridium difficile BI1
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:cdg00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
82212..83693
Genome map
AA seq 493 aa AA seqDB search
MNVRVRFAPSPTGFVHIGSLRTALYNYLFAKKMGGEYILRVEDTDQSRLVEGAIENMLNA
MKWAGVNHSEGVILDDSGKVVQKGEYGPYIQSQRLDIYQEYIKQLLDSGKAYYCFCTKER
LDEVRDAQRAAGETAKYDGHCKNLSKEEVEANIKAGIPYVIRLRLPENHTIKFTDLVRGD
MEFNTNDLDDQVLMKTDGFPTYHFAVVVDDYLMKITHVIRGEEWVSSTPKHVYLYEAFGW
EAPVFVHLPNILNKEKKKLSKRQGDVAVEDFKKKGYLPEGLVNYVALVGWSPEDNQELFT
MEELEKAFSVERVSKSGGVFDTEKLNWVNQHYIKDGDDAYLTDLAIPFLVEDGFITEEEA
TNKYDFLKSMISVLKEKLQYVKEITEHASIFFGDKIEVETEEGREFLRLEHIPTLIDALR
EKIEKTEVLNAEFVQAMLKEIQKEYKIKGKNLFMGSRIILTGQMHGPDLPKVMEVLGKET
CLNRIAYVKNNIL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtaagagtaaggtttgcaccaagtccaacaggatttgtacatataggtagtttg
agaactgctttatataactatttatttgcaaaaaaaatgggtggagaatatatattaaga
gtggaagatacagaccaaagtagattagtagaaggtgctatagagaatatgcttaatgct
atgaaatgggctggtgtcaaccatagtgaaggtgttatattagatgatagtggaaaagta
gtacaaaaaggagaatatggtccatatattcaatctcaaagattagatatataccaagaa
tatataaagcaacttttagatagtggaaaagcttattattgtttctgtacaaaagaaaga
ctggatgaagtaagagatgctcaaagagcagcaggagaaacagctaaatatgatggtcat
tgtaagaatctttctaaagaagaagtagaagcgaatataaaagcaggaataccatatgtt
ataagattaagattgccagagaatcatacaattaagtttacagacttagttagaggagat
atggaatttaatactaatgacctagatgaccaagtattaatgaaaacagatggatttcca
acttatcattttgcagtagttgttgatgactatttgatgaaaattacacatgttataaga
ggagaagaatgggtatcatctactccaaaacatgtttatttatatgaagcttttggatgg
gaagcacctgtatttgtgcatttaccaaatatacttaataaagaaaagaaaaaattaagt
aaaagacaaggtgatgtagctgttgaagactttaagaaaaaaggatatttaccagaggga
ttagtaaactatgtagcattagttggttggtctcctgaagataatcaagaattgtttaca
atggaggaattagaaaaagccttctctgtagaaagagtatctaaaagtggtggagtattt
gatactgaaaaattaaattgggttaatcagcactatataaaagatggtgatgatgcttat
ctaacagacttagcaataccatttttagtagaagatggatttataacagaagaagaagct
actaataaatatgatttcttaaagagtatgatatcagtacttaaagagaaattacaatat
gtaaaagaaattactgaacatgcaagtatattttttggagataaaatagaggtagaaact
gaagagggaagagagttcttaagattagaacatatacctactttaatagatgctttgaga
gaaaaaatagaaaaaacagaggtattaaatgctgagtttgttcaagctatgcttaaagaa
atacaaaaagagtacaaaataaaagggaaaaatttatttatgggctcaagaataattttg
acagggcaaatgcatggtccagatttaccaaaagtaatggaagttttaggaaaagaaact
tgcttaaatagaatagcttatgtaaaaaataatatattatag

DBGET integrated database retrieval system