KEGG   Peptoclostridium difficile BI1: CDBI1_00295Help
Entry
CDBI1_00295       CDS       T01779                                 

Definition
dihydrofolate reductase region
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cdg  Peptoclostridium difficile BI1
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CDBI1_00295
   00670 One carbon pool by folate
    CDBI1_00295
Enzymes [BR:cdg01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     CDBI1_00295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
87360..87854
Genome map
AA seq 164 aa AA seqDB search
MKVIVAVDLNWGIGYGGKLLQSIPEDMKFFKEKTVGNVVVMGRETFKSLPGKKALKDRVN
IVLTRSKSFNDDRLIVCNSIDETLKELQKYENDKIFIIGGETVYKQFLPYCNELYVTKIQ
KTYEADRFFPNIDIMSNWDLIKESEVKEYNNIRYVFSTYINNSL
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttatagtagctgtagatttaaattggggaattggttatggtggaaagttacta
cagtcgattcctgaagatatgaaattttttaaagaaaaaactgtaggtaatgtagttgta
atggggagagaaacctttaaatcattaccaggaaaaaaagcattaaaagatagagtgaat
atagtcttgactagaagtaaatcttttaatgatgatagattgattgtttgtaattctata
gatgaaactcttaaggaactacaaaaatatgaaaatgataaaatttttataataggtgga
gaaacagtatataaacaatttttaccttattgtaatgaactatatgtaacaaaaatacag
aagacatatgaggcggatagatttttccctaatatagatattatgtcaaactgggatttg
attaaagaaagtgaagtaaaagaatataacaatataagatatgttttttcaacatatata
aataatagtttatag

DBGET integrated database retrieval system