KEGG   Clostridium difficile BI1: CDBI1_00685Help
Entry
CDBI1_00685       CDS       T01779                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
cdg  Clostridium difficile BI1
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cdg00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:cdg00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
175948..177201
Genome map
AA seq 417 aa AA seqDB search
MAKIIVKKSNPLKGSVKIDGAKNAVLPIIAATLLANGKSTLNGVPNLRDVHVISDLLRHV
GAEVEYKENTLTVDASNIKTCEAPYELVRKMRASFLVMGPLLARFNSTKISMPGGCAIGT
RPIDLHLKGFKALGAKIEMDHGFVEAATEKLVGNKLYLDFPSVGATENIMMAASLAEGTT
IIENAAEEPEIVDLANFLNEMGADVKGAGTNTIKIKGVKELKGAEHNVIPDRIEAATYMV
AAAMTKGDITVENVLMEHLKPVVAKLREAGCEITEMDNSVRVVGPKVLKPIDIKTLPHPG
FPTDVQAQFMAMLTVANGTGVVIETVFENRFMHVAEFNRMGANIKIDGRSAVVNGVDELH
GAAVNATDLRAGAALILCGLIAEGETQIGEIYHIQRGYVDIDKKITALGGQIEIVED
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggctaagataatagtaaaaaagagtaatccacttaaaggtagtgttaaaatagatggt
gcaaaaaatgcagttttaccaataatagcagcgactttattagcaaacggaaaatcaaca
ttaaatggagtaccaaatttaagagatgttcatgttatatcagatttattaagacatgta
ggagcagaagttgaatataaagaaaatacacttactgttgatgcaagcaatataaaaact
tgtgaagctccatatgagcttgtaagaaagatgagagcttcttttttggttatgggacca
ttgcttgctagatttaatagtacgaaaatttctatgccaggaggatgtgctataggaaca
agacctatagatttacatttaaaaggatttaaagccttaggtgcaaagatagaaatggac
catggttttgttgaagcagcaacagaaaagttagtaggaaataaattatatttagatttc
ccatctgttggagcaactgaaaacataatgatggcagcttctttagcagaagggactaca
ataatagagaatgcagcagaagagccagaaatagtagatttagcaaacttcttgaacgaa
atgggagcagatgttaaaggtgcaggtactaatactataaaaataaaaggtgttaaagag
ttaaaaggagcagaacataatgtaattccagacagaatagaagcagcaacttatatggtt
gcagcagctatgacaaaaggtgatataactgttgaaaatgttttaatggagcatttaaaa
ccagttgtagctaaattaagagaagctggttgcgaaataacagaaatggacaattctgta
agagttgtaggtccaaaagtattaaaaccaatagatataaaaactttaccacatccagga
tttcctacagatgttcaagcacaatttatggctatgcttactgtagccaatggaactggt
gtagttatagaaactgtttttgaaaatagatttatgcatgttgctgaatttaatagaatg
ggtgctaatataaaaatagatggaagaagtgcggttgttaatggtgtagatgagctacac
ggtgcagcagtaaacgctactgatttaagagcgggggcagcccttattttatgcggtctt
atagcagaaggagaaactcaaataggagaaatataccatatccaaagaggttatgttgat
atagataagaagataacagcactaggtggtcaaatcgaaatagtagaagattaa

DBGET integrated database retrieval system