KEGG   Peptoclostridium difficile BI1: CDBI1_00995Help
Entry
CDBI1_00995       CDS       T01779                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
cdg  Peptoclostridium difficile BI1
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdg00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CDBI1_00995
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CDBI1_00995
Enzymes [BR:cdg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     CDBI1_00995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
250385..251305
Genome map
AA seq 306 aa AA seqDB search
MLKSRNLIQPEDFSIEEIDEILELAQKIIDNPSKYSRICEGKLLATLFYEPSTRTRLSFE
SAMNRLGGRVVGFSEPNSSSASKGETLGDTMRIVSGYVDIIAMRHPQSGAASEAARYTEV
PFINAGDGKNQHPTQTLTDLLTIKSLKGTLESHTIGLCGDLKYGRTVHSLVKAMARYKNT
KFVFIAPEELKMPDYIKEAIKGHAYYETNNLDDVIGSLDVLYMTRVQQERFEDKSEYERL
KNYYILNKAKLEKASKDMLVMHPLPRVNEIDIDVDSDDRAVYFKQAKYGMYVRMALIIKL
LGINED
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaatcaagaaatttaatccaaccagaagacttttcaatagaagaaatagatgaa
atattagaattagctcaaaaaataattgacaatccgtcaaaatattctcgtatatgtgaa
ggaaaactattagctacattattttatgaaccatcaacaagaacaagattaagctttgaa
tctgctatgaacagattaggaggacgtgtagtaggcttttcagagccaaattcatcctct
gcatcaaaaggtgaaactctaggagatacaatgaggatagtatctggttatgttgatata
atagctatgagacatcctcaatcaggtgcagcttcagaagcagctagatatacggaagtg
ccatttataaatgcaggagacggcaaaaaccagcatccaactcaaacacttacagactta
cttactataaaatcattaaaaggaactttagaaagccatacaataggattatgtggtgat
ttaaaatatggaagaactgtgcattctttggttaaggctatggcaagatataaaaataca
aagtttgtatttatagcgcctgaagagttaaaaatgccagattatataaaagaagctata
aagggacatgcatattatgaaactaataatttggatgatgttataggaagcttggatgtt
ttatatatgactagagttcaacaagaaaggtttgaagataaatcagagtatgaaagactt
aaaaactattatattttaaataaagctaaattagaaaaggcatctaaagatatgttagta
atgcatccattaccaagagtaaatgaaatagacatagatgtagatagtgatgatagagct
gtatattttaaacaagctaaatatggaatgtatgttagaatggctttaataataaaactt
ttaggtataaatgaagactaa

DBGET integrated database retrieval system