KEGG   Peptoclostridium difficile BI1: CDBI1_01920Help
Entry
CDBI1_01920       CDS       T01779                                 

Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cdg  Peptoclostridium difficile BI1
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cdg00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CDBI1_01920
Enzymes [BR:cdg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     CDBI1_01920
Peptidases [BR:cdg01002]
 Cysteine Peptidases
  Family C44
   CDBI1_01920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
446564..448147
Genome map
AA seq 527 aa AA seqDB search
MINLEEKYLTRKDTYMIKILEYNGHIRNWKVLCEELGIDSSLCRDERERAILVEAYKTWG
YDMANHMHGMFAFALWDTVEKKLFCLRDQFGVKPFYYYETENGKLLYGSSIRKIMEQPGF
VKELNEDMLQIYMSFTYVAGENTFFRGVKKLMPGHYLVYQNKTVCIGRYWKPEFHPDHSK
SIEEWTDEIHTTLQKIMPEVKSENETAELFLSGGVDSSYILAMSDIEKTGSCGYEEERFD
ESKLAQQTANILGCKNSRYIITPEEYFASVPYVMYHMEQPTGDASAIVFAIGCKAAAENT
NICYSGEGADEFFGGYNIYHKAECYGENLKTFYIGNTNIMNEGEKRKILKKYNPDVLPIE
VVKGIYEETEELDTLTNMSNVDIQIWLEGDIYFNIDKMSTAVGLEVRMPLTDTRIFDIAS
RIPSEYKVKGKENKIAFRTAASKTLPEEIAFRNKLGFIVPIRIWMADDQYNKDIRDKFNS
EIADKFFNIDEINEIFNDYISGNSDNWRKIWMIYTFLVWYEIYFVKC
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgataaatttagaagaaaagtatttaacacgaaaagacacatatatgataaaaattcta
gaatacaatggacatattcgaaactggaaagttctctgtgaagaacttggaatcgattct
tcattatgtagagatgagcgtgaacgagcaattttagtggaagcatataagacatgggga
tatgatatggcaaatcacatgcatggaatgtttgcctttgcattatgggatactgtggaa
aagaaactcttctgcctaagagaccagtttggagtaaaacctttctattattatgagact
gaaaatgggaagcttctctatggttcatctattcgtaagattatggagcaaccaggattt
gtgaaagagttaaatgaagacatgttacagatttatatgtctttcacatatgtagcaggt
gaaaatacattcttccgtggagtaaagaagcttatgccaggacattaccttgtctatcag
aataaaacagtatgtattggtcgttattggaaacctgaatttcatcctgaccacagcaag
tctattgaggaatggacggatgaaattcatacaacacttcagaaaattatgccagaggta
aaatcagagaatgaaactgcagagttattcttatcaggaggtgttgattcatcttatata
ttggcaatgtcagatatagaaaaaacaggttcatgtggttatgaggaagagcgttttgat
gaatcaaaattagcacaacagacagctaatattcttgggtgtaaaaattcgagatatata
attacacctgaagagtattttgcgtcagtaccttatgtaatgtaccatatggagcaacca
actggagatgcatctgctatcgtttttgctattggatgcaaggcagcagctgaaaacaca
aatatctgttactctggagaaggagcagatgagttttttggtggatataatatataccat
aaggcagagtgttatggagagaatttgaagacattttatattggaaatacaaacattatg
aatgagggtgagaaaagaaaaattcttaagaaatacaatcctgatgtgcttcctattgaa
gtggtaaaaggaatttatgaagaaacagaagaactagatacacttactaacatgtcaaat
gtagatattcaaatatggttggaaggagatatttattttaatatagataaaatgagtact
gcagttggattggaagtcagaatgcctcttacagatacaagaatatttgatattgcatcc
agaataccatcagaatataaagtgaaaggaaaagagaataaaattgcctttcgtacagct
gcatcaaaaacattaccagaagagattgcttttagaaataaattaggatttattgtgcca
attcgtatatggatggctgatgaccaatataataaggatatccgagataaattcaatagt
gagatagcagataaattctttaacatagatgagattaatgagatttttaatgactacatt
agtggaaactctgataattggagaaagatttggatgatttacacattcctagtgtggtat
gaaatctattttgtaaaatgttaa

DBGET integrated database retrieval system