KEGG   Peptoclostridium difficile BI1: CDBI1_02475Help
Entry
CDBI1_02475       CDS       T01779                                 

Definition
chemotaxis-like protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
cdg  Peptoclostridium difficile BI1
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cdg00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CDBI1_02475
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    CDBI1_02475
Enzymes [BR:cdg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     CDBI1_02475
Two-component system [BR:cdg02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   CDBI1_02475
Bacterial motility proteins [BR:cdg02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    CDBI1_02475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
576229..576825
Genome map
AA seq 198 aa AA seqDB search
MERFNNMVIAIGASVGGTEAILEIIKDLPKSTPGIVVVQHMPAIFTYMYAQRLDKQCIMN
VREAKNNDRVEQGNVLIAPGGYQMKLCTDKQGYYVTCEKGERISGHCPSVDVLFDSVAEV
AGKNSIGIILTGMGYDGANGLLKMKENGLFTIGQDENSCIVYGMPMVAFDRGSVMLQLPL
GEISNCLIRHINILKQKD
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtggaacgttttaataatatggttattgctataggcgcatctgtaggtggtacagaagca
atacttgaaattataaaagacctaccaaaatcaacaccagggattgttgtagttcaacat
atgccagctatatttacttatatgtatgcacaacggcttgacaagcagtgtattatgaat
gtaagagaagctaagaataatgatagagtcgaacaaggaaatgtgttaattgcacctggg
ggttaccagatgaaattgtgtacggataaacaaggatattatgtaacttgtgaaaaagga
gaaagaataagtggtcactgtccatcagtagacgttttgtttgattcagtagcagaagta
gcaggtaaaaattcaataggaataatacttacaggtatgggttatgatggagcaaatgga
cttttaaaaatgaaagaaaatggtttatttacaattggacaggatgaaaattcttgtata
gtatatggaatgccaatggtagcttttgatagaggttctgttatgttacaattacctctt
ggtgaaatttcaaactgtttgataagacatattaatattttaaaacaaaaagattaa

DBGET integrated database retrieval system