KEGG   Peptoclostridium difficile BI1: CDBI1_02555Help
Entry
CDBI1_02555       CDS       T01779                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
cdg  Peptoclostridium difficile BI1
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdg00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CDBI1_02555
   00330 Arginine and proline metabolism
    CDBI1_02555
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CDBI1_02555
Enzymes [BR:cdg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     CDBI1_02555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
593732..594661
Genome map
AA seq 309 aa AA seqDB search
MNTLDETLLKEIISSNKKYTNYGQVASYIPELKNARRNDLGICIIDSENNLYSAGNCSTK
FTIQSISKPIVLAMALMDNDWEDVFSNVGMEPSGDPFNSIMKLEINDTKKPCNPMINAGA
IVTTSLINGSCLEEKEERMLSFFRKLAKNDNIGINYDVYKSEKMTGDRNRAMAYLLKSDG
FIRGNVEDVLDLYFKQCSIEIDSVDLARIGINLANYGVDIENGEHLMSEMVSRIVKTFMM
TCGMYDASGEFAIKVGIPAKSGVGGGIMASVPGRMGIGVYGPALDKKGNSVAGVKVLEEL
SNKLKLNIF
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgttagatgagacattattaaaagaaattataagttctaataagaagtatact
aattatgggcaagtcgctagttacataccagaattaaaaaacgctagaagaaatgattta
ggaatttgtatcatagatagcgaaaataatctttatagtgctggaaactgtagcacaaag
tttactatacaaagtatttcaaaaccaattgtgcttgctatggcacttatggataatgat
tgggaagacgttttttcaaacgttggaatggagccaagtggggacccatttaattcaata
atgaaacttgaaattaatgacacaaaaaaaccctgtaatccaatgataaatgcaggggct
atagtaactacttcccttataaatgggagttgtttagaagaaaaagaagaaagaatgctt
agtttctttagaaagttagcaaaaaatgataatataggaataaactatgatgtctataag
tctgaaaaaatgactggagatagaaacagagctatggcttacttattgaaaagtgatgga
tttatcagagggaatgtagaagatgttctagacctttattttaaacaatgctcaattgag
atagattctgtagatttagcgagaattggaataaatcttgcaaattatggagtagatata
gaaaatggtgagcatttaatgagtgaaatggtttctaggattgtcaagacatttatgatg
acttgtggaatgtatgatgcttctggggaatttgctattaaagttggcattcctgcaaaa
tctggagttgggggtggtataatggcttctgtgccgggacgcatggggattggtgtttat
ggacctgcgcttgacaaaaaaggtaacagcgtcgcaggagttaaagttttagaggagttg
tcaaataaactcaaattaaatattttttaa

DBGET integrated database retrieval system